LAIZ
← Rastah portals

Rastah

T-Shirt

334 listings · PKR 40 – PKR 395

T-Shirt on LAIZ is how Rastah groups this line. 334 products with descriptions, sizes where they apply, and checkout that holds your payment until delivery. Elevate your wardrobe with this piece, meticulously crafted from 100% midweight 270gsm cotton for ultimate comfort.

"+92" royal blue patch T-shirt

T-Shirt

"+92" royal blue patch T-shirt

Elevate your wardrobe with this piece, meticulously crafted from 100% midweight 270gsm cotton for ultimate comfort.

Elevate your wardrobe with this piece, meticulously crafted from 100% midweight 270gsm cotton for ultimate comfort. The oversized fit ensures a relaxed yet stylish look. The patch on the back, handwoven from cotton, serves as a poignant reminder of the situation in Pakistan - a colorful and inviting facade hiding a broken and conflicted reality. The Urdu script text on the patch reads, "We are unable to reach the current number," symbolizing the difficulties faced by many. The front of the shirt features the Rastah logo and Pakistan's cell phone area code, tying the design together. Midweight 270gsm cotton for optimal comfort Oversized fit for a relaxed yet stylish look Handwoven cotton patch on the back representing the situation in Pakistan Urdu script text on the patch Rastah logo and Pakistan's cell phone area code on the front Male model 5'11 wearing medium, female model 5'8 wearing medium Available for purchase on the 25th of April, with shipping starting on the 27th.

  • Midweight 270gsm cotton for optimal comfort
  • Oversized fit for a relaxed yet stylish look
  • Handwoven cotton patch on the back representing the situation in Pakistan
  • Urdu script text on the patch
  • Rastah logo and Pakistan's cell phone area code on the front
  • Male model 5'11 wearing medium, female model 5'8 wearing medium
Product type
T-Shirt
Vendor
APRIL CAPSULE 23
Compare at
PKR 88
SKU +92ROYALBLUEPATCHTSHIRT-S-01

Sizes / variants: S · Black · Blue · Green · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"21 jump street" jersey shirt

T-Shirt

"21 jump street" jersey shirt

A tribute to the classic sports jerseys of the '90s.

A tribute to the classic sports jerseys of the '90s. This piece features striking red stripes along the sleeves, reminiscent of the iconic sports jerseys prevalent in '90s hip-hop culture. Embracing the era's signature fashion, this jersey's front logos pay homage to the sponsorship emblems commonly seen on sports jerseys during that decade. The player number on the back completes the look and feel of the piece Technical Specifications: 100% polyester construction Red striped sleeves reminiscent of '90s sports jerseys. Multiple front Rastah logos in different styles Care Instructions: Machine wash on a gentle cycle. Use mild detergent. Tumble dry on low heat. Do not iron or dry clean. Male Model Information: Height: 5'10" Weight: 150 lbs Size Worn: Medium Female Model Information: Height: 5'5" Weight: 110 lbs Size Worn: Small AVAILABILITY: Products will be launched for purchase on December 28th, with shipping commencing from January 18th.

  • 100% polyester construction
  • Red striped sleeves reminiscent of '90s sports jerseys.
  • Multiple front Rastah logos in different styles
  • Machine wash on a gentle cycle.
  • Use mild detergent.
  • Tumble dry on low heat.
  • Do not iron or dry clean.
  • Height: 5'10"
  • Weight: 150 lbs
  • Size Worn: Medium
  • Height: 5'5"
  • Weight: 110 lbs
Product type
T-Shirt
Vendor
INTERMISSION 9
SKU 21JUMPSTREETJERSEYSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 141

Currently unavailable

View in 3DFull listing
"21 jump street" jersey shirt

T-Shirt

"21 jump street" jersey shirt

A tribute to the classic sports jerseys of the '90s.

A tribute to the classic sports jerseys of the '90s. This piece features striking red stripes along the sleeves, reminiscent of the iconic sports jerseys prevalent in '90s hip-hop culture. Embracing the era's signature fashion, this jersey's front logos pay homage to the sponsorship emblems commonly seen on sports jerseys during that decade. The player number on the back completes the look and feel of the piece Technical Specifications: 100% polyester construction Red striped sleeves reminiscent of '90s sports jerseys. Multiple front Rastah logos in different styles Care Instructions: Machine wash on a gentle cycle. Use mild detergent. Tumble dry on low heat. Do not iron or dry clean. Male Model Information: Height: 5'10" Weight: 150 lbs Size Worn: Medium Female Model Information: Height: 5'5" Weight: 110 lbs Size Worn: Small AVAILABILITY: Products will be launched for purchase on December 28th, with shipping commencing from January 18th.

  • 100% polyester construction
  • Red striped sleeves reminiscent of '90s sports jerseys.
  • Multiple front Rastah logos in different styles
  • Machine wash on a gentle cycle.
  • Use mild detergent.
  • Tumble dry on low heat.
  • Do not iron or dry clean.
  • Height: 5'10"
  • Weight: 150 lbs
  • Size Worn: Medium
  • Height: 5'5"
  • Weight: 110 lbs
Product type
T-Shirt
Vendor
INTERMISSION 9
SKU 21JUMPSTREETJERSEYSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 141

Currently unavailable

View in 3DFull listing
"555" squash black T-shirt

T-Shirt

"555" squash black T-shirt

The t shirt is an ode to Pakistan's and unarguably the worlds most successful squash player - Jahangir Khan.

The t shirt is an ode to Pakistan's and unarguably the worlds most successful squash player - Jahangir Khan. Khan was unbeaten for 555 consecutive matches spanning over a period of 5 years and 8 months. The t shirt printed using a distressed vintage effect. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah INTERMISSION IV monogram screen printed on front hand screen printed artwork on the back Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6'1 ; wearing: Medium | Female Model: 5'7; Wearing small

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah INTERMISSION IV monogram screen printed on front
  • hand screen printed artwork on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6'1 ; wearing: Medium | Female Model: 5'7; Wearing small
Product type
T-Shirt
Vendor
INTERMISSION 4
Compare at
PKR 79
SKU 555SQUASHBLACKT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
"97 limit" T-shirt

T-Shirt

"97 limit" T-shirt

The "97 Limit" T-shirt features a bold graphic design celebrating the essence of Lahore's street culture.

The "97 Limit" T-shirt features a bold graphic design celebrating the essence of Lahore's street culture. Made from 100% cotton with a soft, 220 GSM fabric, it combines a classic crew neck with an oversized fit, providing ultimate comfort and a relaxed silhouette. The front showcases the Rastah logo in screen print, while the back is adorned with a retro-inspired car graphic, checkerboard detail, and "97 Limit" slogan in contrasting white and pink tones. Shipping will begin between 1st-4th November Key Features: Fabric: 100% cotton, 220 GSM Fit: Oversized, relaxed silhouette Front Design: Screen-printed Rastah logo Back Design: Retro car graphic with "Lahore" text, checkerboard detail, and "97 Limit" slogan Color: Black base with white and pink screen prints Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low Iron on reverse if needed Do not dry clean Model Information: Male Model: 5'11", wearing size M Female Model: 5'6", wearing size S

  • Fabric: 100% cotton, 220 GSM
  • Fit: Oversized, relaxed silhouette
  • Front Design: Screen-printed Rastah logo
  • Back Design: Retro car graphic with "Lahore" text, checkerboard detail, and "97 Limit" slogan
  • Color: Black base with white and pink screen prints
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low
  • Iron on reverse if needed
  • Do not dry clean
  • Male Model: 5'11", wearing size M
  • Female Model: 5'6", wearing size S
Product type
T-Shirt
Vendor
OCTOBER CAPSULE 2024
SKU 97LIMITTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 101

Currently unavailable

View in 3DFull listing
"Acid" crop top

T-Shirt

"Acid" crop top

This crop top fuses vintage aesthetics with contemporary street style, featuring an acid wash treatment that offers a rugged, worn-in look.

This crop top fuses vintage aesthetics with contemporary street style, featuring an acid wash treatment that offers a rugged, worn-in look. The high-density printed logo at the chest stands out against the washed fabric, creating a bold contrast. Made from 100% cotton, this tee is soft, breathable, and comfortable for all-day wear. The fitted cut and short sleeves provide a flattering, edgy fit perfect for layering or wearing on its own. Shipping will begin between 1st-4th November Key Features: Material: 100% Cotton Fit: Crop Fit Color: Acid Black Logo: High-density screen print at front Acid wash finish for a vintage look Short sleeves Care Instructions: Machine wash cold with similar colors Do not bleach Tumble dry low or hang dry Do not iron directly on the print Model Information: Male model is 5'11" wearing size M Female model is 5'6" wearing size S

  • Material: 100% Cotton
  • Fit: Crop Fit
  • Color: Acid Black
  • Logo: High-density screen print at front
  • Acid wash finish for a vintage look
  • Short sleeves
  • Machine wash cold with similar colors
  • Do not bleach
  • Tumble dry low or hang dry
  • Do not iron directly on the print
  • Male model is 5'11" wearing size M
  • Female model is 5'6" wearing size S
Product type
T-Shirt
Vendor
OCTOBER CAPSULE 2024
Compare at
PKR 75
SKU ACIDCROPTOP-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 45

Currently unavailable

View in 3DFull listing
"Ajnabi" printed black T-shirt

T-Shirt

"Ajnabi" printed black T-shirt

The deep black hue sets the backdrop for a contemporary oversized silhouette, designed for comfort without compromising on style.

The deep black hue sets the backdrop for a contemporary oversized silhouette, designed for comfort without compromising on style. The front bears the Rastah logo, serving as a hallmark of quality and brand recognition. However, it is the back that evokes deep reflection, featuring screen-printed artwork that presents the poignant Urdu text: "We are still strangers, despite sharing the same history." It's a reminder of shared journeys, forgotten connections, and the underlying ties that bind us all. Technical Specifications : 100% cotton. 220gsm weight. Oversized fit. Front Rastah logo print. Screen-printed artwork on the back. Urdu text on the back translating to "We are still strangers, despite sharing the same history." Washing Instructions : Machine wash cold with like colors. Tumble dry low or lay flat to dry. Do not bleach. Avoid direct sunlight. Male Model Information : Height: 5'10" Weight: 150 lbs Wearing Size: Medium Female Model Information : Height: 5'5" Weight: 110 lbs Wearing Size: Small AVAILABILITY : Products will be launched on 21st September and shipped out on 1st October.

  • 100% cotton.
  • 220gsm weight.
  • Oversized fit.
  • Front Rastah logo print.
  • Screen-printed artwork on the back.
  • Urdu text on the back translating to "We are still strangers, despite sharing the same history."
  • Machine wash cold with like colors.
  • Tumble dry low or lay flat to dry.
  • Do not bleach.
  • Avoid direct sunlight.
  • Height: 5'10"
  • Weight: 150 lbs
Product type
T-Shirt
Vendor
VOLUME X
Compare at
PKR 88
SKU AJNABIPRINTEDBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Ajnabi" printed black T-shirt

T-Shirt

"Ajnabi" printed black T-shirt

The deep black hue sets the backdrop for a contemporary oversized silhouette, designed for comfort without compromising on style.

The deep black hue sets the backdrop for a contemporary oversized silhouette, designed for comfort without compromising on style. The front bears the Rastah logo, serving as a hallmark of quality and brand recognition. However, it is the back that evokes deep reflection, featuring screen-printed artwork that presents the poignant Urdu text: "We are still strangers, despite sharing the same history." It's a reminder of shared journeys, forgotten connections, and the underlying ties that bind us all. Technical Specifications : 100% cotton. 220gsm weight. Oversized fit. Front Rastah logo print. Screen-printed artwork on the back. Urdu text on the back translating to "We are still strangers, despite sharing the same history." Washing Instructions : Machine wash cold with like colors. Tumble dry low or lay flat to dry. Do not bleach. Avoid direct sunlight. Male Model Information : Height: 5'10" Weight: 150 lbs Wearing Size: Medium Female Model Information : Height: 5'5" Weight: 110 lbs Wearing Size: Small AVAILABILITY : Products will be launched on 21st September and shipped out on 1st October.

  • 100% cotton.
  • 220gsm weight.
  • Oversized fit.
  • Front Rastah logo print.
  • Screen-printed artwork on the back.
  • Urdu text on the back translating to "We are still strangers, despite sharing the same history."
  • Machine wash cold with like colors.
  • Tumble dry low or lay flat to dry.
  • Do not bleach.
  • Avoid direct sunlight.
  • Height: 5'10"
  • Weight: 150 lbs
Product type
T-Shirt
Vendor
VOLUME X
Compare at
PKR 88
SKU AJNABIPRINTEDBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Ankh aur andhera" cropped T-shirt

T-Shirt

"Ankh aur andhera" cropped T-shirt

“Ankh aur andhera” croptop features a rastah logo at the front and hand printed details on the back.

“Ankh aur andhera” croptop features a rastah logo at the front and hand printed details on the back. A hand with the third eye in the middle reads “Ankh aur andhera” that loosely translates to “ the eye and the darkness” the title of the shirt is inspired from a novel by a Pakistani feminist surrealistic writer Afra Bukhari. slightly oversized fit and cropped in length 200 gsm heavyweight fleece in a cotton and polyester mix Rastah logo printed on the front hand screen printed elements on the back Washing/Handling: Hand wash with cold water inside out & hang to dry Female Model: 5'9 and 105 lbs wearing small *THIS COLLECTION WILL BE AVAILABLE ON THE 21st FOR SALE AND WILL BE SHIPPED ON THE 23rd*

  • slightly oversized fit and cropped in length
  • 200 gsm heavyweight fleece in a cotton and polyester mix
  • Rastah logo printed on the front
  • hand screen printed elements on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
INTERMISSION VI
Compare at
PKR 66
SKU ANKHAURANDHERACROPPEDT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 66

Currently unavailable

View in 3DFull listing
"Aqua" garment dyed logo T-shirt

T-Shirt

"Aqua" garment dyed logo T-shirt

Rastah logo t-shirt with a newly designed limited edition logo.

Rastah logo t-shirt with a newly designed limited edition logo. Each piece is garment dyed using a unique pigment dyeing technique that gives the piece a slightly faded vintage look. The garment is constructed from soft midweight terry fabric made to order to Rastah's specification and fits oversized. This is a true collectible piece with its dye formulation and logo design, and will never be reproduced again. *THIS COLLECTION GOES LIVE ON THE 21ST OF MARCH AND WILL SHIP OUT FROM THE 30TH OF MARCH* *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit Garment dyed using a pigment wash technique for a faded vintage look Rastah March'23 limited edition logo screen printed 80% cotton and 20% polyester midweight terry fabric Washing/Handling: Hand wash with cold water inside out & hang to dry Male model is 5'10 150 lbs and wears size medium

  • slightly oversized fit
  • Garment dyed using a pigment wash technique for a faded vintage look
  • Rastah March'23 limited edition logo screen printed
  • 80% cotton and 20% polyester midweight terry fabric
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male model is 5'10 150 lbs and wears size medium
Product type
T-Shirt
Vendor
MARCH DELIVERY
Compare at
PKR 62
SKU AQUAGARMENTDYEDLOGOTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 62

Currently unavailable

View in 3DFull listing
"Azaadi" printed mustard T-shirt

T-Shirt

"Azaadi" printed mustard T-shirt

Crafted in a bright mustard hue, the T-shirt's oversized fit is both contemporary and comfortable.

Crafted in a bright mustard hue, the T-shirt's oversized fit is both contemporary and comfortable. On the back, an evocative Urdu script poses the poignant question, "When will we be free?", echoing the sentiments of generations past and present. The front reveals an excerpt from a newspaper during the British Raj era. Technical Specifications : 100% cotton terry. 220gsm weight. Oversized fit. Printed artwork on front and back. Urdu text on the back. Newspaper excerpt from the British Raj on the front. Washing Instructions : Machine wash cold with like colors. Tumble dry low or lay flat to dry. Do not bleach. Avoid direct sunlight. Male Model Information : Height: 5'10" Weight: 150 lbs Wearing Size: Medium Female Model Information : Height: 5'5" Weight: 110 lbs Wearing Size: Small AVAILABILITY : Products will be launched on 21st September and shipped out on 1st October.

  • 100% cotton terry.
  • 220gsm weight.
  • Oversized fit.
  • Printed artwork on front and back.
  • Urdu text on the back.
  • Newspaper excerpt from the British Raj on the front.
  • Machine wash cold with like colors.
  • Tumble dry low or lay flat to dry.
  • Do not bleach.
  • Avoid direct sunlight.
  • Height: 5'10"
  • Weight: 150 lbs
Product type
T-Shirt
Vendor
VOLUME X
Compare at
PKR 88
SKU AZAADIPRINTEDMUSTARDTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 53

Currently unavailable

View in 3DFull listing
"Azaadi" printed mustard T-shirt

T-Shirt

"Azaadi" printed mustard T-shirt

Crafted in a bright mustard hue, the T-shirt's oversized fit is both contemporary and comfortable.

Crafted in a bright mustard hue, the T-shirt's oversized fit is both contemporary and comfortable. On the back, an evocative Urdu script poses the poignant question, "When will we be free?", echoing the sentiments of generations past and present. The front reveals an excerpt from a newspaper during the British Raj era. Technical Specifications : 100% cotton terry. 220gsm weight. Oversized fit. Printed artwork on front and back. Urdu text on the back. Newspaper excerpt from the British Raj on the front. Washing Instructions : Machine wash cold with like colors. Tumble dry low or lay flat to dry. Do not bleach. Avoid direct sunlight. Male Model Information : Height: 5'10" Weight: 150 lbs Wearing Size: Medium Female Model Information : Height: 5'5" Weight: 110 lbs Wearing Size: Small

  • 100% cotton terry.
  • 220gsm weight.
  • Oversized fit.
  • Printed artwork on front and back.
  • Urdu text on the back.
  • Newspaper excerpt from the British Raj on the front.
  • Machine wash cold with like colors.
  • Tumble dry low or lay flat to dry.
  • Do not bleach.
  • Avoid direct sunlight.
  • Height: 5'10"
  • Weight: 150 lbs
Product type
T-Shirt
Vendor
VOLUME X
SKU AZAADIPRINTEDMUSTARDTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Blondie" graphic T-shirt

T-Shirt

"Blondie" graphic T-shirt

A bold reinterpretation of summer streetwear.

A bold reinterpretation of summer streetwear. Crafted from 100% cotton, this light blue t-shirt features a clean Urdu logo on the front, while the back bursts with a vibrant screen-printed illustration layered with surrealist and pop-art motifs. The artwork, created by Pakistani artist Maha Farooq , captures the energy of cultural fusion and modern rebellion — designed for everyday ease with a statement edge. Key Features 100% Cotton Screen print at back Urdu logo at front Relaxed, oversized silhouette Care Instructions Machine wash cold with like colors Do not bleach Tumble dry low Iron inside out if needed

  • 100% Cotton
  • Screen print at back
  • Urdu logo at front
  • Relaxed, oversized silhouette
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low
  • Iron inside out if needed
Product type
T-Shirt
Vendor
STUDIO 54
SKU BLONDIEGRAPHICT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 106

Currently unavailable

View in 3DFull listing
"Bubblegum" printed T-shirt

T-Shirt

"Bubblegum" printed T-shirt

The Acid Washed T-shirt, adorned with the Rastah logo on the front and accent embroidery stitches on the back, delivers a unique visual experience.

The Acid Washed T-shirt, adorned with the Rastah logo on the front and accent embroidery stitches on the back, delivers a unique visual experience. The garment's oversized design is matched by the strength and comfort of its cotton-polyester blend. Key Features: Acid washed, oversized T-shirt Made from a 270 GSM 80/20 cotton-polyester mix terry fabric Rastah logo printed on the front Rastah English logo with accent embroidery stitches on the back Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Acid washed, oversized T-shirt
  • Made from a 270 GSM 80/20 cotton-polyester mix terry fabric
  • Rastah logo printed on the front
  • Rastah English logo with accent embroidery stitches on the back
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU BUBBLEGUMPRINTEDTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Bubblegum" printed T-shirt

T-Shirt

"Bubblegum" printed T-shirt

The Acid Washed T-shirt, adorned with the Rastah logo on the front and accent embroidery stitches on the back, delivers a unique visual experience.

The Acid Washed T-shirt, adorned with the Rastah logo on the front and accent embroidery stitches on the back, delivers a unique visual experience. The garment's oversized design is matched by the strength and comfort of its cotton-polyester blend. Key Features: Acid washed, oversized T-shirt Made from a 270 GSM 80/20 cotton-polyester mix terry fabric Rastah logo printed on the front Rastah English logo with accent embroidery stitches on the back Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Acid washed, oversized T-shirt
  • Made from a 270 GSM 80/20 cotton-polyester mix terry fabric
  • Rastah logo printed on the front
  • Rastah English logo with accent embroidery stitches on the back
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU BUBBLEGUMPRINTEDTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Butterfly effect" black T-shirt

T-Shirt

"Butterfly effect" black T-shirt

This black oversized t-shirt is made from 220 GSM 100% cotton fabric, offering a relaxed and comfortable fit.

This black oversized t-shirt is made from 220 GSM 100% cotton fabric, offering a relaxed and comfortable fit. The front is minimalistic with an embroidered logo, while the back features bold, graffiti-style artwork with multiple "RA$TAH" logos stacked on top of each other in red, white, and blue, surrounded by abstract scribbles and two yellow butterflies that add a pop of color. Ideal for layering or wearing on its own, this piece blends streetwear aesthetics with a contemporary vibe, making it a versatile addition to any wardrobe. Shipping will begin between 1st-4th October Care Instructions: Machine wash cold, gentle cycle Wash with similar colors Do not bleach Tumble dry low Cool iron if necessary Model Specifications: Male Model: 6'0", 135 lbs, wearing size Medium. Female Model: 5'6", 110 lbs, wearing size Small.

  • Machine wash cold, gentle cycle
  • Wash with similar colors
  • Do not bleach
  • Tumble dry low
  • Cool iron if necessary
  • Male Model: 6'0", 135 lbs, wearing size Medium.
  • Female Model: 5'6", 110 lbs, wearing size Small.
Product type
T-Shirt
Vendor
VOLUME 12
SKU BUTTERFLYEFFECTBLACKTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Cavalry ground" crop top

T-Shirt

"Cavalry ground" crop top

Embrace the allure of dusk with our "Nightfall Boulevard Crop Top," a captivating blend of style and nostalgia.

Embrace the allure of dusk with our "Nightfall Boulevard Crop Top," a captivating blend of style and nostalgia. Crafted from black ribbed fabric, this crop top features uniquely crafted high shoulders and short sleeves, creating a silhouette that exudes confidence and sophistication. At the front, a luminescent hand-drawn Rastah logo adds a touch of elegance and intrigue, while the focal point steals a glimpse of Lahore's Cavalry Ground main boulevard at sunset, captured in the rearview mirror. Key Features: Black ribbed fabric for a sleek and sophisticated look Uniquely crafted high shoulders and short sleeves Luminescent hand-drawn Rastah logo on the front Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Hand wash cold with like colors Do not bleach Lay flat to dry Iron on low heat if needed Do not dry clean

  • Black ribbed fabric for a sleek and sophisticated look
  • Uniquely crafted high shoulders and short sleeves
  • Luminescent hand-drawn Rastah logo on the front
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Hand wash cold with like colors
  • Do not bleach
  • Lay flat to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
MAY CAPSULE 24
SKU CAVALRYGROUNDCROPTOP-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
"City slicker" beige T-shirt

T-Shirt

"City slicker" beige T-shirt

Explore the world in the City Slicker Beige T-Shirt .

Explore the world in the City Slicker Beige T-Shirt . Crafted from 100% cotton, this shirt combines comfort with bold streetwear vibes. The front showcases the iconic Rastah logo in a striking print, while the back features a list of global cities in both English and Urdu—representing a tribute to worldwide street culture. The playful, puffed “Rastah” print at the top enhances the urban vibe, making this tee a standout piece. Shipping will begin between 1st-4th November Key Features: Material: 100% cotton Color: Beige Front Design: High-density red Rastah logo print Back Design: "Rastah" print with a list of major global cities in both English and Urdu Fit: Regular fit, true to size Sleeve: Short-sleeve Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang dry Iron inside-out on low if needed Do not iron on the print Model Information: Male Model: 5'11" wearing size M Female Model: 5'6" wearing size S

  • Material: 100% cotton
  • Color: Beige
  • Front Design: High-density red Rastah logo print
  • Back Design: "Rastah" print with a list of major global cities in both English and Urdu
  • Fit: Regular fit, true to size
  • Sleeve: Short-sleeve
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang dry
  • Iron inside-out on low if needed
  • Do not iron on the print
  • Male Model: 5'11" wearing size M
Product type
T-Shirt
Vendor
OCTOBER CAPSULE 2024
SKU CITYSLICKERBEIGETSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 101

Currently unavailable

View in 3DFull listing
"Clouds above" printed patchwork T-shirt

T-Shirt

"Clouds above" printed patchwork T-shirt

This piece, with Urdu text stands out with its unique screen print on the back.

This piece, with Urdu text stands out with its unique screen print on the back. Initially hand-drawn, the print offers a distinctly artistic touch. The Rastah logo sits on the front, while the Urdu text on the back reads, "Have no fear of perfection, you'll never reach it." Key Features: Oversized black T-shirt Rastah logo on the front Unique screen print on the back, initially hand-drawn Urdu text on the back reads, "Have no fear of perfection, you'll never reach it" Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Oversized black T-shirt
  • Rastah logo on the front
  • Unique screen print on the back, initially hand-drawn
  • Urdu text on the back reads, "Have no fear of perfection, you'll never reach it"
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU CLOUDSABOVEPRINTEDPATCHWORKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Clouds above" printed patchwork T-shirt

T-Shirt

"Clouds above" printed patchwork T-shirt

This piece, with Urdu text stands out with its unique screen print on the back.

This piece, with Urdu text stands out with its unique screen print on the back. Initially hand-drawn, the print offers a distinctly artistic touch. The Rastah logo sits on the front, while the Urdu text on the back reads, "Have no fear of perfection, you'll never reach it." Key Features: Oversized black T-shirt Rastah logo on the front Unique screen print on the back, initially hand-drawn Urdu text on the back reads, "Have no fear of perfection, you'll never reach it" Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Oversized black T-shirt
  • Rastah logo on the front
  • Unique screen print on the back, initially hand-drawn
  • Urdu text on the back reads, "Have no fear of perfection, you'll never reach it"
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU CLOUDSABOVEPRINTEDPATCHWORKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Crimson stitch" artisan T-shirt

T-Shirt

"Crimson stitch" artisan T-shirt

An exclusive offering for our loyal customers, the "Crimson Stitch" Artisan Tee redefines comfort with artistic detail.

An exclusive offering for our loyal customers, the "Crimson Stitch" Artisan Tee redefines comfort with artistic detail. Crafted from soft 100% terry cotton, this tee features striking hand-stitched accents on the cuffs and hem, alongside a unique embroidered front motif and an intricate back patch. It's a testament to refined craftsmanship and your valued loyalty. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: Premium Terry Cotton: 100% soft, comfortable, and breathable fabric. Hand-Stitched Details: Distinctive crimson hand-stitching on sleeves and hem. Artisan Embellishments: Features a unique embroidered front motif and an intricate back patch. Relaxed Fit: Designed for effortless style and comfort. Exclusive Loyalty Offering: Limited-edition item for valued clientele. Care Instructions: Dry clean only

  • Premium Terry Cotton: 100% soft, comfortable, and breathable fabric.
  • Hand-Stitched Details: Distinctive crimson hand-stitching on sleeves and hem.
  • Artisan Embellishments: Features a unique embroidered front motif and an intricate back patch.
  • Relaxed Fit: Designed for effortless style and comfort.
  • Exclusive Loyalty Offering: Limited-edition item for valued clientele.
Product type
T-Shirt
Vendor
enclave exclusive
SKU RASTAH-10132781269304

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 220

Currently unavailable

View in 3DFull listing
"Dazed confusion" oversized cotton T-shirt

T-Shirt

"Dazed confusion" oversized cotton T-shirt

Introducing our "Dazed Confusion" Oversized Cotton T-Shirt, a perfect fusion of artistic expression and contemporary streetwear.

Introducing our "Dazed Confusion" Oversized Cotton T-Shirt, a perfect fusion of artistic expression and contemporary streetwear. Crafted from premium cotton, this oversized t-shirt features a front logo patch with dynamic artwork and a striking screen-printed design on the back. The circular artwork patch on the back is complemented by the text "Dazed and Confused" written in Urdu, adding a unique cultural touch. Key Features: Premium cotton fabric Oversized fit Front logo patch with artwork Screen-printed design on the back with circular artwork patch "Dazed and Confused" text in Urdu Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Premium cotton fabric
  • Oversized fit
  • Front logo patch with artwork
  • Screen-printed design on the back with circular artwork patch
  • "Dazed and Confused" text in Urdu
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
JULY CAPSULE 24
SKU DAZEDCONFUSIONOVERSIZEDCOTTONT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Destiny" beige T-shirt

T-Shirt

"Destiny" beige T-shirt

This piece in beige features hand drawn artwork by Rastah's very own in house illustrator - Hanif Niazi.

This piece in beige features hand drawn artwork by Rastah's very own in house illustrator - Hanif Niazi. The piece showcases text on the back by Mirza Ghalib in Urdu which roughly translates to "Fate does not lie in the lines of your hand, for even those without hands can carve their own destiny" slightly oversized fit 250 gsm lightweight terry in a cotton and polyester mix Screen printed elements on the front, and handwoven printed patch on back Rastah logo printed on the front Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6'2 and 175 lbs wearing: Medium | Female Model: 5'9 wearing small *THIS COLLECTION WILL BE AVAILABLE ON THE 18th OF SEPTEMBER FOR SALE AND WILL BE SHIPPED ON THE 23rd OF SEPTEMBER

  • slightly oversized fit
  • 250 gsm lightweight terry in a cotton and polyester mix
  • Screen printed elements on the front, and handwoven printed patch on back
  • Rastah logo printed on the front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6'2 and 175 lbs wearing: Medium | Female Model: 5'9 wearing small
Product type
T-Shirt
Vendor
VOLUME VIII
SKU DESTINYBEIGETSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 86

Currently unavailable

View in 3DFull listing
"Dil mera 2gb" screen print T-shirt

T-Shirt

"Dil mera 2gb" screen print T-shirt

Lightweight and oversized t shirt with a hand screen printed design on the back created by Alyan Tareen.

Lightweight and oversized t shirt with a hand screen printed design on the back created by Alyan Tareen. The artwork is inspired by a juxtaposition of personal trauma and losing a loved one. The design is hand screen printed slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah Volume VI monogram screen printed on front Hand screen printed design Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'11 and 150 lbs wearing: Medium | Female Model: 5'10 and 105 lbs wearing small *This is a limited edition item. No restocks*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah Volume VI monogram screen printed on front
  • Hand screen printed design
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'11 and 150 lbs wearing: Medium | Female Model: 5'10 and 105 lbs wearing small
Product type
T-Shirt
Vendor
VOLUME VI
SKU DILMERA2GBSCREENPRINTTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
"Duality" printed black T-shirt

T-Shirt

"Duality" printed black T-shirt

Introducing our "Duality" Printed Black T-Shirt, a sophisticated blend of style and substance.

Introducing our "Duality" Printed Black T-Shirt, a sophisticated blend of style and substance. Crafted from 100% cotton terry, this t-shirt offers a plush, comfortable feel with a substantial 220 GSM weight. The oversized fit ensures a relaxed yet fashionable look, perfect for any casual occasion. The front features a sleek logo, while the back showcases a striking artwork that embodies the concept of duality, making this piece a versatile and meaningful addition to your wardrobe. Key Features: 100% cotton terry for a soft, comfortable texture 220 GSM for a premium, substantial feel Oversized fit for a relaxed, stylish look Logo on the front Striking duality-themed artwork printed on the back Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on medium heat if needed Do not dry clean

  • 100% cotton terry for a soft, comfortable texture
  • 220 GSM for a premium, substantial feel
  • Oversized fit for a relaxed, stylish look
  • Logo on the front
  • Striking duality-themed artwork printed on the back
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on medium heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
MAY CAPSULE 24
SKU DUALITYPRINTEDBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Emperors circus" hand block print T-shirt

T-Shirt

"Emperors circus" hand block print T-shirt

A soft, breathable t-shirt crafted from 100% cotton terry (120 GSM).

A soft, breathable t-shirt crafted from 100% cotton terry (120 GSM). Showcasing traditional block print designs with intricate patterns and cultural motifs. Key Features: 100% cotton terry fabric (120 GSM) for lightweight comfort. Handcrafted block print artwork with vibrant detailing. Relaxed fit for everyday wear. Care Instructions: Machine wash cold, gentle cycle. Do not bleach. Tumble dry low or hang to dry. Cool iron on reverse if necessary.

  • 100% cotton terry fabric (120 GSM) for lightweight comfort.
  • Handcrafted block print artwork with vibrant detailing.
  • Relaxed fit for everyday wear.
  • Machine wash cold, gentle cycle.
  • Do not bleach.
  • Tumble dry low or hang to dry.
  • Cool iron on reverse if necessary.
Product type
T-Shirt
Vendor
Naqsh - Invite Only Collection
SKU RASTAH-9820554723640

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 158

Currently unavailable

View in 3DFull listing
“Equilibrium” printed T-shirt

T-Shirt

“Equilibrium” printed T-shirt

This t shirt is the perfect spring/summer statement piece with various abstract print details overlayed on top of each other.

This t shirt is the perfect spring/summer statement piece with various abstract print details overlayed on top of each other. The garment is entirely digitally printed in shades of balck grey and red. slightly oversized fit 400 GSM cotton/polyester mix french terry Digitally printed Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'10 and 105 lbs wearing small

  • slightly oversized fit
  • 400 GSM cotton/polyester mix french terry
  • Digitally printed
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'10 and 105 lbs wearing small
Product type
T-Shirt
Vendor
VOLUME VII
SKU “EQUILIBRIUM”PRINTEDTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 53

Currently unavailable

View in 3DFull listing
"Error" blue T-shirt

T-Shirt

"Error" blue T-shirt

The "Error" T-shirt is a bold statement piece crafted from 100% cotton with a soft, breathable feel.

The "Error" T-shirt is a bold statement piece crafted from 100% cotton with a soft, breathable feel. This light blue oversized tee features a prominent graphic of the Rastah logo on the front, drawn in a chaotic, graffiti-like design. The back showcases a standout error message graphic, incorporating Urdu typography that reads "design not found," adding a rebellious twist to this urban look. The playful irony of the error message combined with the unique streetwear design embodies a mix of digital culture and modern aesthetic. Shipping will begin between 1st-4th November Key Features: 100% cotton, 220 GSM for a soft and comfortable feel. Oversized fit for a relaxed silhouette. Front: Graffiti-style graphic of the Rastah logo. Back: Bold error message graphic with Urdu typography reading "design not found." Color: Light blue. Unisex design suitable for all genders. Model Information: Male model: 5'11", wearing size M. Female model: 5'6", wearing size S. Care Instructions: Machine wash cold with like colors. Tumble dry low or hang to dry. Do not bleach. Iron inside out on low heat if needed. Do not iron directly on printed graphics.

  • 100% cotton, 220 GSM for a soft and comfortable feel.
  • Oversized fit for a relaxed silhouette.
  • Front: Graffiti-style graphic of the Rastah logo.
  • Back: Bold error message graphic with Urdu typography reading "design not found."
  • Color: Light blue.
  • Unisex design suitable for all genders.
  • Male model: 5'11", wearing size M.
  • Female model: 5'6", wearing size S.
  • Machine wash cold with like colors.
  • Tumble dry low or hang to dry.
  • Do not bleach.
  • Iron inside out on low heat if needed.
Product type
T-Shirt
Vendor
OCTOBER CAPSULE 2024
SKU ERRORBLUETSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 101

Currently unavailable

View in 3DFull listing
"Eternal cycle" oversized rust brown T-shirt

T-Shirt

"Eternal cycle" oversized rust brown T-shirt

Introducing our "Eternal Cycle" Oversized Rust Brown T-Shirt, a piece that merges profound artistic expression with contemporary streetwear.

Introducing our "Eternal Cycle" Oversized Rust Brown T-Shirt, a piece that merges profound artistic expression with contemporary streetwear. This t-shirt, in a unique rust brown hue, is crafted from premium cotton for an oversized fit that offers both comfort and style. The front features a logo patch, while the back boasts a striking artwork patch that explores the concept of the circular nature of life and the feeling of being trapped in a loop. Key Features: Premium cotton fabric Oversized fit Front logo patch Back artwork patch Artwork Description: The artwork on the back is a mesmerizing depiction inspired by the cyclical nature of life. It features a detailed and intricate design with elements symbolizing the repetition and loops we often find ourselves in. The central figure, with its enigmatic expression, is surrounded by abstract patterns and symbols, reflecting the complexity and layers of life's ongoing cycle. Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Premium cotton fabric
  • Oversized fit
  • Front logo patch
  • Back artwork patch
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
JULY CAPSULE 24
SKU ETERNALCYCLEOVERSIZEDRUSTBROWNT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Eternal cycle" oversized rust brown T-shirt

T-Shirt

"Eternal cycle" oversized rust brown T-shirt

Introducing our "Eternal Cycle" Oversized Rust Brown T-Shirt, a piece that merges profound artistic expression with contemporary streetwear.

Introducing our "Eternal Cycle" Oversized Rust Brown T-Shirt, a piece that merges profound artistic expression with contemporary streetwear. This t-shirt, in a unique rust brown hue, is crafted from premium cotton for an oversized fit that offers both comfort and style. The front features a logo patch, while the back boasts a striking artwork patch that explores the concept of the circular nature of life and the feeling of being trapped in a loop. Key Features: Premium cotton fabric Oversized fit Front logo patch Back artwork patch Artwork Description: The artwork on the back is a mesmerizing depiction inspired by the cyclical nature of life. It features a detailed and intricate design with elements symbolizing the repetition and loops we often find ourselves in. The central figure, with its enigmatic expression, is surrounded by abstract patterns and symbols, reflecting the complexity and layers of life's ongoing cycle. Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Premium cotton fabric
  • Oversized fit
  • Front logo patch
  • Back artwork patch
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
JULY CAPSULE 24
SKU ETERNALCYCLEOVERSIZEDRUSTBROWNT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Forever forest" maroon full-sleeve T-shirt

T-Shirt

"Forever forest" maroon full-sleeve T-shirt

Introducing our "forever forest" Long Sleeve T-Shirt, a blend of artistry and premium craftsmanship.

Introducing our "forever forest" Long Sleeve T-Shirt, a blend of artistry and premium craftsmanship. This maroon oversized t-shirt is made from 100% compact combed cotton, ensuring a soft and luxurious feel. With a fabric weight of 220 GSM, it offers both durability and comfort. The full-sleeved design makes it perfect for any season, while the hand screen-printed artwork on the back and the logo on the front add a touch of exclusivity. Produced in limited quantities with no restocks, this piece is a true collector's item. Key Features: 100% compact combed cotton for a premium, soft texture 220 GSM for optimal weight and comfort Oversized fit for a relaxed and stylish look Full-sleeved design for versatility Hand screen-printed artwork on the back Logo printed on the front Limited quantity with no restocks Model Information: Male model: 6'1", wearing size Large Female model: 5'8", wearing size Medium Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on medium heat if needed Do not dry clean

  • 100% compact combed cotton for a premium, soft texture
  • 220 GSM for optimal weight and comfort
  • Oversized fit for a relaxed and stylish look
  • Full-sleeved design for versatility
  • Hand screen-printed artwork on the back
  • Logo printed on the front
  • Limited quantity with no restocks
  • Male model: 6'1", wearing size Large
  • Female model: 5'8", wearing size Medium
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
Product type
T-Shirt
Vendor
MAY CAPSULE 24
SKU FOREVERFORESTMAROONFULLSLEEVETSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
"Fuck the aunties" red long sleeve T-shirt

T-Shirt

"Fuck the aunties" red long sleeve T-shirt

Long sleeve t shirt in carmine red colour and Rastah volume V logo screen printed on the front along with screen printed text in english - "fuck the aunties".

Long sleeve t shirt in carmine red colour and Rastah volume V logo screen printed on the front along with screen printed text in english - "fuck the aunties". The garment also includes sleeve and back patch detailing of in house crafted designs. This piece fits slightly oversized. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah Volume V monogram screen printed on front printed sleeve and back patches fuck the aunties screen print text Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6ft ; wearing: Medium

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah Volume V monogram screen printed on front
  • printed sleeve and back patches
  • fuck the aunties screen print text
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6ft ; wearing: Medium
Product type
T-Shirt
Vendor
VOLUME V
Compare at
PKR 106
SKU FUCKTHEAUNTIESREDLONGSLEEVET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 106

Currently unavailable

View in 3DFull listing
"Games we play" printed beige T-shirt

T-Shirt

"Games we play" printed beige T-shirt

The front features the signature Rastah logo, while the back is embellished with a screen-printed image of a TV and an Urdu text that translates to: "What games

The front features the signature Rastah logo, while the back is embellished with a screen-printed image of a TV and an Urdu text that translates to: "What games are you playing?" A distinctive blend of casual and playful elements, the piece stands out with its oversized design and its 270 GSM 80/20 cotton-polyester mix terry fabric. Key Features: Beige, oversized T-shirt Crafted from a 270 GSM 80/20 cotton-polyester mix terry fabric Rastah logo printed on the front Back features a screen-printed TV image and Urdu text Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Beige, oversized T-shirt
  • Crafted from a 270 GSM 80/20 cotton-polyester mix terry fabric
  • Rastah logo printed on the front
  • Back features a screen-printed TV image and Urdu text
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU GAMESWEPLAYPRINTEDBEIGETSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Games we play" printed beige T-shirt

T-Shirt

"Games we play" printed beige T-shirt

The front features the signature Rastah logo, while the back is embellished with a screen-printed image of a TV and an Urdu text that translates to: "What games

The front features the signature Rastah logo, while the back is embellished with a screen-printed image of a TV and an Urdu text that translates to: "What games are you playing?" A distinctive blend of casual and playful elements, the piece stands out with its oversized design and its 270 GSM 80/20 cotton-polyester mix terry fabric. Key Features: Beige, oversized T-shirt Crafted from a 270 GSM 80/20 cotton-polyester mix terry fabric Rastah logo printed on the front Back features a screen-printed TV image and Urdu text Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Beige, oversized T-shirt
  • Crafted from a 270 GSM 80/20 cotton-polyester mix terry fabric
  • Rastah logo printed on the front
  • Back features a screen-printed TV image and Urdu text
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
Compare at
PKR 88
SKU GAMESWEPLAYPRINTEDBEIGETSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Graffiti" jacquard crop top

T-Shirt

"Graffiti" jacquard crop top

This Jacquard Knit Crop Top is designed to make a bold statement with its vibrant red and black stripe pattern.

This Jacquard Knit Crop Top is designed to make a bold statement with its vibrant red and black stripe pattern. Featuring the Rastah logo in an abstract, graffiti-inspired style on the front, it brings an edgy, streetwear vibe to your wardrobe. Made from a soft and durable jacquard knit, this top has a relaxed fit with a slightly cropped cut, making it both stylish and comfortable. Shipping will begin between 15th-20th November Key Features Material : High-quality jacquard knit Fit : Relaxed, slightly cropped Color : Red and black stripes Design Details : Graffiti-style Rastah logo on the front Oversized collar Short sleeves Style : Unisex, versatile for layering or wearing on its own Care Instructions Hand wash or machine wash cold Do not bleach Lay flat to dry Model Information Male Model : 5'11" (180 cm), wearing size M Female Model : 5'6" (168 cm), wearing size S

  • Material : High-quality jacquard knit
  • Fit : Relaxed, slightly cropped
  • Color : Red and black stripes
  • Design Details : Graffiti-style Rastah logo on the front
  • Oversized collar
  • Short sleeves
  • Style : Unisex, versatile for layering or wearing on its own
  • Hand wash or machine wash cold
  • Do not bleach
  • Lay flat to dry
  • Male Model : 5'11" (180 cm), wearing size M
  • Female Model : 5'6" (168 cm), wearing size S
Product type
T-Shirt
Vendor
OCTOBER CAPSULE 2024
SKU GRAFFITIJACQUARDCROPTOP-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 229

In stock · ready to checkout

View in 3DBuy nowFull listing
"House of chaos" T-shirt

T-Shirt

"House of chaos" T-shirt

Introducing our "House of Chaos" T-Shirt, a striking blend of chaos and serenity in design.

Introducing our "House of Chaos" T-Shirt, a striking blend of chaos and serenity in design. Crafted from a blue cotton base, this shirt features a chaotic black block print design all over, balanced by calming lapses of white cutlines for visual contrast. The May Capsule 24 Rastah logo is printed on denim in front, adding a touch of urban flair to the design. With its 220 GSM fabric and oversized fit, this shirt offers both style and comfort for your everyday adventures. Key Features: Blue cotton fabric base with chaotic black block print Calming lapses of white cutlines for visual contrast May Capsule 24 Rastah logo printed on denim in front Oversized fit for relaxed style Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low Warm iron if needed

  • Blue cotton fabric base with chaotic black block print
  • Calming lapses of white cutlines for visual contrast
  • May Capsule 24 Rastah logo printed on denim in front
  • Oversized fit for relaxed style
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low
  • Warm iron if needed
Product type
T-Shirt
Vendor
MAY CAPSULE 24
SKU HOUSEOFCHAOST-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 176

Currently unavailable

View in 3DFull listing
"I am nobody" grey T-shirt

T-Shirt

"I am nobody" grey T-shirt

Lightweight and oversized t shirt with a hand screen printed design on the back with some puff print elements.

Lightweight and oversized t shirt with a hand screen printed design on the back with some puff print elements. The text on the whole piece is a repetition of a phrase, which is english written in urdu reading as “i am nobody who are you” slightly oversized fit 400 gsm heavyweight fleece in a cotton and polyester mix Rastah logo printed on the front hand screen and puff printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small *This is a limited edition item. No restocks* *This piece will be launching on the 20th of March at 1pm EST/10pm PAK time. All orders will start to ship from the 25th of March*

  • slightly oversized fit
  • 400 gsm heavyweight fleece in a cotton and polyester mix
  • Rastah logo printed on the front
  • hand screen and puff printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
VOLUME VII
Compare at
PKR 79
SKU IAMNOBODYGREYT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
"I hate school" printed black T-shirt

T-Shirt

"I hate school" printed black T-shirt

"I hate school" printed black T-shirt

"I hate school" printed black T-shirt from official Rastah storefront.

  • T-Shirt
  • INTERMISSION 8
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU IHATESCHOOLPRINTEDBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"I hate school" printed black T-shirt

T-Shirt

"I hate school" printed black T-shirt

"I hate school" printed black T-shirt

"I hate school" printed black T-shirt from official Rastah storefront.

  • T-Shirt
  • INTERMISSION 8
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU IHATESCHOOLPRINTEDBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Incendies" T-shirt

T-Shirt

"Incendies" T-shirt

Introducing our "Incendies" T-Shirt, a profound exploration of how the spaces in our memory shape our sense of self.

Introducing our "Incendies" T-Shirt, a profound exploration of how the spaces in our memory shape our sense of self. This white oversized t-shirt, made from 100% cotton at 220 GSM, offers a perfect blend of comfort and durability. The front features the May Capsule 24 Rastah logo, while the back showcases the powerful Urdu typography "Pechaan Meri" alongside a striking black graphic. The design delves into the concept of losing oneself due to the negative spaces in one's memory, reflecting on how we often change daily and lose sight of who we once were. The text "Pechaan Meri" (Recognize Me) and the fading silhouette of a person poignantly capture this theme. Key Features: 100% cotton fabric for comfort and breathability 220 GSM for a premium feel Oversized fit for a relaxed and stylish look May Capsule 24 Rastah logo patch on the front "Pechaan Meri" in Urdu typography and a fading silhouette graphic on the back Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on medium heat if needed Do not dry clean

  • 100% cotton fabric for comfort and breathability
  • 220 GSM for a premium feel
  • Oversized fit for a relaxed and stylish look
  • May Capsule 24 Rastah logo patch on the front
  • "Pechaan Meri" in Urdu typography and a fading silhouette graphic on the back
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on medium heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
MAY CAPSULE 24
SKU INCENDIEST-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 106

Currently unavailable

View in 3DFull listing
"Into the abyss" long-sleeve T-shirt

T-Shirt

"Into the abyss" long-sleeve T-shirt

This sweatshirt is inspired by concepts of renewal and rebirth of the mind, performed through psychoactive plants by shams dating back to 900 B.C.The garment co

This sweatshirt is inspired by concepts of renewal and rebirth of the mind, performed through psychoactive plants by shams dating back to 900 B.C.The garment consists of various hand screen printed design elements throughout. The urdu text on the back is english written in urdu - “into the abyss we fall”. slightly oversized fit 200 gsm lightweight cotton and polyester mix Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small *This is a limited edition item. No restocks* *This piece will be launching on the 20th of March at 1pm EST/10pm PAK time. All orders will start to ship from the 25th of March*

  • slightly oversized fit
  • 200 gsm lightweight cotton and polyester mix
  • Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
VOLUME VII
Compare at
PKR 79
SKU INTOTHEABYSSLONG-SLEEVETSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
"Is this it?" black T-shirt

T-Shirt

"Is this it?" black T-shirt

The "Is this it?" T-Shirt asks a simple question "What do you really want?".

The "Is this it?" T-Shirt asks a simple question "What do you really want?". Sounds simple, right? The more you think the harder it gets. Don't worry, you don't have to answer now, maybe not even in a week, or a month, or even a year...but eventually you will, we all have to. Oversized fit 270 GSM 80% Cotton, 20% Polyester Unique "Hybrid" Rastah logo on the front Artwork on the front and back Washing/Handling: hand wash with cold water and hang to dry Male model 5'9 and 150 lbs wears medium ; female model 5'8 wears small *This collection will be available for purchase on the 12th of February and orders will ship out starting the 15th of February*

  • Oversized fit
  • 270 GSM 80% Cotton, 20% Polyester
  • Unique "Hybrid" Rastah logo on the front
  • Artwork on the front and back
  • Washing/Handling: hand wash with cold water and hang to dry
  • Male model 5'9 and 150 lbs wears medium ; female model 5'8 wears small
Product type
T-Shirt
Vendor
VOLUME IX
SKU ISTHISIT?BLACKT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Kabhi khushi kabhi gham" ocean green T-shirt

T-Shirt

"Kabhi khushi kabhi gham" ocean green T-shirt

Navigating life's complex dichotomy of joy and sorrow, the "Kabhi Khushi, Kabhi Gham" T-Shirt interprets a famed Bollywood line through the lens of the circus.

Navigating life's complex dichotomy of joy and sorrow, the "Kabhi Khushi, Kabhi Gham" T-Shirt interprets a famed Bollywood line through the lens of the circus. Balancing profundity with playfulness, the design becomes a symbolic beacon of resilience, eloquently encouraging its wearer to face life's ebbs and flows with fortitude. Product Specs: Material: 100% compact combed cotton GSM: 230 Fit: Oversized Color: Ocean Green Model Info: Male Model: 5'11, wearing a size Medium Female Model: 5'6, wearing a size Small Washing Instructions: Hand wash with cold water and hang to dry. Or machine wash in cold water and dry on low heat. Available for purchase on the 25th of July, with shipping starting on the 28th of July.

  • Material: 100% compact combed cotton
  • GSM: 230
  • Fit: Oversized
  • Color: Ocean Green
  • Male Model: 5'11, wearing a size Medium
  • Female Model: 5'6, wearing a size Small
Product type
T-Shirt
Vendor
Rastah
SKU KABHIKHUSHIKABHIGHAMOCEANGREENTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Karachi nights" beige T-shirt

T-Shirt

"Karachi nights" beige T-shirt

The Karachi Nights Tee is made from premium 220 GSM 100% cotton, offering both comfort and style.

The Karachi Nights Tee is made from premium 220 GSM 100% cotton, offering both comfort and style. This oversized t-shirt features vibrant artwork by Adeen Habib, capturing the dynamic energy of Karachi’s nightlife. The front showcases bold Rastah typography layered in contrasting colors, while the back depicts a whimsical scene of Karachi's socialites in an abstract, artistic expression. With its lightweight and breathable fabric, this tee is perfect for both casual and statement wear, blending streetwear with artistic flair. Shipping will begin between 1st-4th October Care Instructions : Machine wash cold Do not bleach Tumble dry low Cool iron if needed Do not dry clean Model Specifications: Male Model: 6'0", 135 lbs, wearing size Medium. Female Model: 5'6", 110 lbs, wearing size Small.

  • Machine wash cold
  • Do not bleach
  • Tumble dry low
  • Cool iron if needed
  • Do not dry clean
  • Male Model: 6'0", 135 lbs, wearing size Medium.
  • Female Model: 5'6", 110 lbs, wearing size Small.
Product type
T-Shirt
Vendor
VOLUME 12
SKU KARACHINIGHTSBEIGETSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Life is a circus" printed beige T-shirt

T-Shirt

"Life is a circus" printed beige T-shirt

Presenting the contemplative "Life is a Circus" Black T-Shirt.

Presenting the contemplative "Life is a Circus" Black T-Shirt. This thought-provoking design symbolizes the intricate balancing act of life itself. No matter how hard we strive to keep all aspects of our lives in perfect equilibrium, to someone, we might appear as jesters. Hence, the front of this shirt reads, "We are all clowns," a candid reflection of life's beautiful absurdities. Specifications: Fabric: 100% compact combed cotton terry. Weight: 230 GSM. Fit: Oversized. Model Specifications: Male model: 5'11", wearing a size Medium. Female model: 5'6", wearing a size Small. Washing Instructions: Hand wash with cold water and hang to dry. Or machine wash in cold water and dry on low heat. This piece will be available for purchase on the 25th of July, with shipping commencing from the 28th of July.

  • Fabric: 100% compact combed cotton terry.
  • Weight: 230 GSM.
  • Fit: Oversized.
  • Male model: 5'11", wearing a size Medium.
  • Female model: 5'6", wearing a size Small.
Product type
T-Shirt
Vendor
Rastah
SKU LIFEISACIRCUSPRINTEDBEIGETSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Line of fire" printed beige T-shirt

T-Shirt

"Line of fire" printed beige T-shirt

Screen printed beige t shirt in an oversized fit with the Rastah logo on the front of the garment.

Screen printed beige t shirt in an oversized fit with the Rastah logo on the front of the garment. Some of the urdu text in the image translates to: " Do you know what is in my heart?" and "In this fire of despair, I have been caught". 270 gsm terry 80% cotton 20% polyester oversized fit screen printed graphic on the front Washing/Handling: hand wash with cold water and hang to dry male model 5'10 and 150 lbs wearing medium , female model 5'8 wearing small *This collection will be available for purchase on the 12th of February and orders will ship out starting the 15th of February*

  • 270 gsm terry 80% cotton 20% polyester
  • oversized fit
  • screen printed graphic on the front
  • Washing/Handling: hand wash with cold water and hang to dry
  • male model 5'10 and 150 lbs wearing medium , female model 5'8 wearing small
Product type
T-Shirt
Vendor
VOLUME IX
SKU LINEOFFIREPRINTEDBEIGETSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Lost in symbols" graphic T-shirt

T-Shirt

"Lost in symbols" graphic T-shirt

Crafted from soft cotton fabric, this t-shirt features an abstract screen-printed artwork that speaks in surreal symbols and electric colors.

Crafted from soft cotton fabric, this t-shirt features an abstract screen-printed artwork that speaks in surreal symbols and electric colors. The bold back design is inspired by fragmented thoughts, urban mythology, and subconscious journeys — a visual story in motion. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: Fabric: 100% cotton jersey Bold multicolor screen print on the back Ribbed crew neckline Relaxed fit Lightweight and breathable texture Care Instructions: Dry clean only

  • Fabric: 100% cotton jersey
  • Bold multicolor screen print on the back
  • Ribbed crew neckline
  • Relaxed fit
  • Lightweight and breathable texture
  • Dry clean only
Product type
T-Shirt
Vendor
Songs of the Desert
SKU LOSTINSYMBOLSGRAPHICT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
"Lost in time" acid washed oversized T-shirt

T-Shirt

"Lost in time" acid washed oversized T-shirt

Introducing our "Lost in Time" Acid Washed Oversized T-Shirt, a striking piece that blends contemporary streetwear with artistic flair.

Introducing our "Lost in Time" Acid Washed Oversized T-Shirt, a striking piece that blends contemporary streetwear with artistic flair. This t-shirt, in a unique purple hue, features a distinctive acid wash and is crafted from premium cotton for maximum comfort. The front showcases a logo artwork patch, while the back features a bold artwork patch accompanied by screen-printed Urdu text that reads, "Lost to the world which I once knew." Key Features: Premium cotton fabric Acid washed in purple Oversized fit Front logo artwork patch Back artwork patch with screen-printed Urdu text Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Premium cotton fabric
  • Acid washed in purple
  • Oversized fit
  • Front logo artwork patch
  • Back artwork patch with screen-printed Urdu text
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
JULY CAPSULE 24
SKU LOSTINTIMEACIDWASHEDOVERSIZEDT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Lost in time" acid washed oversized T-shirt

T-Shirt

"Lost in time" acid washed oversized T-shirt

Introducing our "Lost in Time" Acid Washed Oversized T-Shirt, a striking piece that blends contemporary streetwear with artistic flair.

Introducing our "Lost in Time" Acid Washed Oversized T-Shirt, a striking piece that blends contemporary streetwear with artistic flair. This t-shirt, in a unique purple hue, features a distinctive acid wash and is crafted from premium cotton for maximum comfort. The front showcases a logo artwork patch, while the back features a bold artwork patch accompanied by screen-printed Urdu text that reads, "Lost to the world which I once knew." Key Features: Premium cotton fabric Acid washed in purple Oversized fit Front logo artwork patch Back artwork patch with screen-printed Urdu text Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Premium cotton fabric
  • Acid washed in purple
  • Oversized fit
  • Front logo artwork patch
  • Back artwork patch with screen-printed Urdu text
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
JULY CAPSULE 24
SKU LOSTINTIMEACIDWASHEDOVERSIZEDT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Lucky irani" screen print T-shirt

T-Shirt

"Lucky irani" screen print T-shirt

Challenging societal norms with a strong visual statement, Rastah presents the "Lucky Irani Circus" Black T-Shirt.

Challenging societal norms with a strong visual statement, Rastah presents the "Lucky Irani Circus" Black T-Shirt. This audacious piece, inspired by the famed "Lucky Irani Circus," disrupts the stereotypical narrative that marriage is the zenith for women. Rendered in a commanding black hue, the shirt celebrates the diverse realities of women's lives, debunking stereotypes and paving the way for a new discourse. Specifications: Fabric: 100% compact combed cotton terry. Weight: 230 GSM. Fit: Oversized. Model Specifications: Male model: 5'11", wearing a size Medium. Female model: 5'6", wearing a size Small. Washing Instructions: Hand wash with cold water and hang to dry. Or machine wash in cold water and dry on low heat. Available for purchase on the 25th of July, with shipping starting on the 28th of July.

  • Fabric: 100% compact combed cotton terry.
  • Weight: 230 GSM.
  • Fit: Oversized.
  • Male model: 5'11", wearing a size Medium.
  • Female model: 5'6", wearing a size Small.
Product type
T-Shirt
Vendor
Rastah
SKU LUCKYIRANISCREENPRINTTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Man in the dark" handprinted grey T-shirt

T-Shirt

"Man in the dark" handprinted grey T-shirt

Lightweight and oversized t shirt with a hand screen printed design on the back.

Lightweight and oversized t shirt with a hand screen printed design on the back. The artwork is inspired by a juxtaposition of personal trauma and losing loved ones. The design is hand screen printed. slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah Volume VI monogram screen printed on front Hand screen printed design Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'11 and 150 lbs wearing: Medium | Female Model: 5'10 and 105 lbs wearing small *This is a limited edition item. No restocks*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah Volume VI monogram screen printed on front
  • Hand screen printed design
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'11 and 150 lbs wearing: Medium | Female Model: 5'10 and 105 lbs wearing small
Product type
T-Shirt
Vendor
VOLUME VI
Compare at
PKR 79
SKU MANINTHEDARKHANDPRINTEDGREYTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
"My place" printed patchwork T-shirt

T-Shirt

"My place" printed patchwork T-shirt

This piece, cut in an oversized silhouette, makes a relaxed statement.

This piece, cut in an oversized silhouette, makes a relaxed statement. Crafted in a 250 GSM cotton-polyester blend, it features patches on the sleeve and back. The Rastah logo adorns the front, while an Urdu quote on the back translates to "make space for yourself". Key Features: Oversized lavender T-shirt 250 GSM cotton-polyester blend Patches on the sleeve and back Rastah logo on the front Urdu quote on the back, translating to "make space for yourself" Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Oversized lavender T-shirt
  • 250 GSM cotton-polyester blend
  • Patches on the sleeve and back
  • Rastah logo on the front
  • Urdu quote on the back, translating to "make space for yourself"
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU MYPLACEPRINTEDPATCHWORKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"My place" printed patchwork T-shirt

T-Shirt

"My place" printed patchwork T-shirt

This piece, cut in an oversized silhouette, makes a relaxed statement.

This piece, cut in an oversized silhouette, makes a relaxed statement. Crafted in a 250 GSM cotton-polyester blend, it features patches on the sleeve and back. The Rastah logo adorns the front, while an Urdu quote on the back translates to "make space for yourself". Key Features: Oversized lavender T-shirt 250 GSM cotton-polyester blend Patches on the sleeve and back Rastah logo on the front Urdu quote on the back, translating to "make space for yourself" Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Oversized lavender T-shirt
  • 250 GSM cotton-polyester blend
  • Patches on the sleeve and back
  • Rastah logo on the front
  • Urdu quote on the back, translating to "make space for yourself"
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU MYPLACEPRINTEDPATCHWORKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
“Nazar aur asteroid” oversized T-shirt

T-Shirt

“Nazar aur asteroid” oversized T-shirt

Oversized black tee crafted from 220 GSM 100% cotton terry for soft, breathable structure.

Oversized black tee crafted from 220 GSM 100% cotton terry for soft, breathable structure. Back features a vibrant, comic-style “Nazar aur Asteroid” screen print in bold colors. Accented with a pink Rastah logo on the front chest for a clean, elevated finish. Key Features: 220 GSM 100% cotton terry Oversized fit with drop shoulders Multicolor comic-style screen print on back Pink screen-printed Rastah logo on chest Breathable, mid-weight construction Care Instructions: Dry clean only

  • 220 GSM 100% cotton terry
  • Oversized fit with drop shoulders
  • Multicolor comic-style screen print on back
  • Pink screen-printed Rastah logo on chest
  • Breathable, mid-weight construction
  • Dry clean only
Product type
T-Shirt
Vendor
UNLUCKY CHARMS
SKU “NAZARAURASTEROID”OVERSIZEDT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 119

Currently unavailable

View in 3DFull listing
"Nazar-E-Samandar" T-shirt

T-Shirt

"Nazar-E-Samandar" T-shirt

"NAZAR-E-SAMANDAR" captures the spirit of the coast with a bold screen-printed back featuring boats, sun, and Urdu verses.

"NAZAR-E-SAMANDAR" captures the spirit of the coast with a bold screen-printed back featuring boats, sun, and Urdu verses. The front is minimal, with a soft blue “Raasta” logo grounding it in identity. Printed on cream cotton, this tee blends nostalgic storytelling with modern streetwear energy. Key Features: Large screen-printed coastal artwork on the back Urdu “Raasta” logo on front Soft, breathable cotton Relaxed fit with summer-ready ease Cream tone for a fresh, airy vibe Care Instructions: Machine wash cold, inside out Do not bleach Tumble dry low or hang to dry Iron inside out on low heat (avoid print) Do not dry clean

  • Large screen-printed coastal artwork on the back
  • Urdu “Raasta” logo on front
  • Soft, breathable cotton
  • Relaxed fit with summer-ready ease
  • Cream tone for a fresh, airy vibe
  • Machine wash cold, inside out
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low heat (avoid print)
  • Do not dry clean
Product type
T-Shirt
Vendor
Naqsh-e-Rooh
SKU NAZAR-E-SAMANDARTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Nazar-E-Shaam" T-shirt

T-Shirt

"Nazar-E-Shaam" T-shirt

"Nazar-e-Shaam" captures the stillness of a fading evening — a moment suspended in color, light, and imagination.

"Nazar-e-Shaam" captures the stillness of a fading evening — a moment suspended in color, light, and imagination. The screen-printed artwork on the back evokes a surreal landscape: a red house beneath a layered twilight sky, with expressive Urdu script drifting like poetry across the clouds. On the front, a simple “Raasta” sits boldly in red — quiet but powerful. Printed on a soft black cotton base, this tee is an ode to reflection — where art, nostalgia, and identity meet. Key Features: Oversized multicolor screen print on the back Front red “Raasta” Urdu logo print Made from soft, breathable cotton Relaxed, streetwear-inspired fit A blend of surreal art and cultural storytelling Care Instructions: Machine wash cold, inside out Do not bleach Tumble dry low or hang to dry Iron inside out on low heat (avoid print) Do not dry clean

  • Oversized multicolor screen print on the back
  • Front red “Raasta” Urdu logo print
  • Made from soft, breathable cotton
  • Relaxed, streetwear-inspired fit
  • A blend of surreal art and cultural storytelling
  • Machine wash cold, inside out
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low heat (avoid print)
  • Do not dry clean
Product type
T-Shirt
Vendor
Naqsh-e-Rooh
SKU NAZAR-E-SHAAMTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
“Nishaan” acid-wash embroidered T-shirt

T-Shirt

“Nishaan” acid-wash embroidered T-shirt

A classic black acid-wash t-shirt with scattered hand-embroidered motifs and center stones.

A classic black acid-wash t-shirt with scattered hand-embroidered motifs and center stones. Includes a hand-embroidered Rastah logo and raw edge finishes for an aged aesthetic. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features : 100% terry cotton Acid-wash finish Hand-embroidered logo and motifs Stones embedded in embroidery Relaxed fit with raw edge finish Care Instructions : Dry clean only

  • 100% terry cotton
  • Acid-wash finish
  • Hand-embroidered logo and motifs
  • Stones embedded in embroidery
  • Relaxed fit with raw edge finish
  • Dry clean only
Product type
T-Shirt
Vendor
Songs of the Desert
SKU “NISHAAN”ACID-WASHEMBROIDEREDT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
"Ocean love" garment dyed logo T-shirt

T-Shirt

"Ocean love" garment dyed logo T-shirt

Rastah logo t-shirt with a newly designed limited edition logo.

Rastah logo t-shirt with a newly designed limited edition logo. Each piece is garment dyed using a unique pigment dyeing technique that gives the piece a slightly faded vintage look. The garment is constructed from soft midweight terry fabric made to order to Rastah's specification and fits oversized. This is a true collectible piece with its dye formulation and logo design, and will never be reproduced again. *THIS COLLECTION GOES LIVE ON THE 21ST OF MARCH AND WILL SHIP OUT FROM THE 30TH OF MARCH* *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit Garment dyed using a pigment wash technique for a faded vintage look Rastah March'23 limited edition logo screen printed 80% cotton and 20% polyester midweight terry fabric Washing/Handling: Hand wash with cold water inside out & hang to dry Male model is 5'10 150 lbs and wears size medium

  • slightly oversized fit
  • Garment dyed using a pigment wash technique for a faded vintage look
  • Rastah March'23 limited edition logo screen printed
  • 80% cotton and 20% polyester midweight terry fabric
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male model is 5'10 150 lbs and wears size medium
Product type
T-Shirt
Vendor
MARCH DELIVERY
Compare at
PKR 62
SKU OCEANLOVEGARMENTDYEDLOGOTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 62

Currently unavailable

View in 3DFull listing
"Paray hutt" patchwork black T-shirt

T-Shirt

"Paray hutt" patchwork black T-shirt

Made from 270gsm cotton, this tee boasts an oversized fit for ultimate comfort.

Made from 270gsm cotton, this tee boasts an oversized fit for ultimate comfort. The handwoven patches on the front and back feature graffiti-style artwork and Urdu typography, inspired by the graffiti often seen in public bathrooms and clubs. The front patch reads "Paray Hutt" (Go Away), while the back patch features a snake with a skull, symbolizing the betrayal of those who were once trusted. The concept behind this piece is about accepting the differences between people and acknowledging the fact that people can be different in front of you than behind your back. The Rastah Black Oversized T-Shirt encourages us to embrace these differences and remain true to ourselves. The piece is heavily inspired by the Pakistani rock band Karakoram and their song "Gol Chakkar" . 270gsm cotton for optimal comfort Oversized fit for ultimate comfort Handwoven patches on the front and back Graffiti-style artwork and Urdu typography Male model 5'11 wearing medium, female model 5'8 wearing small Available for purchase on the 25th of April, with shipping starting on the 27th.

  • 270gsm cotton for optimal comfort
  • Oversized fit for ultimate comfort
  • Handwoven patches on the front and back
  • Graffiti-style artwork and Urdu typography
  • Male model 5'11 wearing medium, female model 5'8 wearing small
Product type
T-Shirt
Vendor
APRIL CAPSULE 23
Compare at
PKR 88
SKU PARAYHUTTPATCHWORKBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"People talk" printed black T-shirt

T-Shirt

"People talk" printed black T-shirt

Screen printed black t shirt with rastah logo on the front and printed artwork on the back.

Screen printed black t shirt with rastah logo on the front and printed artwork on the back. The printed text in Urdu on the back translates to "people will say things, its what they were born to do" slightly oversized fit 250 gsm terry in a cotton and polyester mix Screen printed elements on the back Rastah logo printed on the front Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 wearing small

  • slightly oversized fit
  • 250 gsm terry in a cotton and polyester mix
  • Screen printed elements on the back
  • Rastah logo printed on the front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 wearing small
Product type
T-Shirt
Vendor
VOLUME VIII
Compare at
PKR 66
SKU PEOPLETALKPRINTEDBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 66

Currently unavailable

View in 3DFull listing
"Perpetual motion" oversized black T-shirt

T-Shirt

"Perpetual motion" oversized black T-shirt

Introducing our "Perpetual Motion" Oversized Black T-Shirt, a statement piece that combines artistic depth with modern streetwear.

Introducing our "Perpetual Motion" Oversized Black T-Shirt, a statement piece that combines artistic depth with modern streetwear. Crafted from premium cotton, this oversized t-shirt features intricate artwork patches on the back, a front logo patch, and a meaningful screen-printed text on the sleeve. Key Features: Premium cotton fabric Oversized fit Front logo patch Back artwork patches Sleeve screen-printed text Artwork Description: The back showcases a series of artwork patches, each depicting abstract and thought-provoking imagery that resonates with the theme of life's perpetual motion and the endless cycle of dawn and dusk. The collage of images creates a powerful visual narrative, inviting viewers to ponder the ceaseless flow of time and existence. Sleeve Text: "In a world of perpetual motion, where dawn and dusk chase each other in an endless dance, the circle of life unfolds." Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Premium cotton fabric
  • Oversized fit
  • Front logo patch
  • Back artwork patches
  • Sleeve screen-printed text
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
JULY CAPSULE 24
SKU PERPETUALMOTIONOVERSIZEDBLACKT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
"Pit of death" screen printed black T-shirt

T-Shirt

"Pit of death" screen printed black T-shirt

In an homage to the electrifying circus attractions of Pakistan and India.

In an homage to the electrifying circus attractions of Pakistan and India. This dramatic piece illustrates the heart-stopping stunt where performers daringly ride bikes along the walls of the 'well of death'. The bold print is adorned with the adage, "Money makes the mare go," symbolizing the exhilarating interplay between risk, financial chase, and the pursuit of success. Specifications: Fabric: 100% compact combed cotton terry. Weight: 230 GSM. Fit: Oversized. Model Specifications: Male model: 5'11", wearing a size Medium. Female model: 5'6", wearing a size Small. Washing Instructions: Hand wash with cold water and hang to dry. Or machine wash in cold water and dry on low heat.

  • Fabric: 100% compact combed cotton terry.
  • Weight: 230 GSM.
  • Fit: Oversized.
  • Male model: 5'11", wearing a size Medium.
  • Female model: 5'6", wearing a size Small.
Product type
T-Shirt
Vendor
Rastah
SKU PITOFDEATHSCREENPRINTEDBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Radiant horizon" baby blue crop top

T-Shirt

"Radiant horizon" baby blue crop top

a perfect blend of style and comfort.

a perfect blend of style and comfort. This fitted crop top is designed to enhance your silhouette, while the front features the distinctive Rastah artwork logo patch. Key Features: Soft baby cotton fabric Fitted shape for a flattering silhouette Front Rastah artwork logo patch Model Information: Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Soft baby cotton fabric
  • Fitted shape for a flattering silhouette
  • Front Rastah artwork logo patch
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
JULY CAPSULE 24
SKU RADIANTHORIZONBABYBLUECROPTOP-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
"Radiant horizon" baby blue crop top

T-Shirt

"Radiant horizon" baby blue crop top

a perfect blend of style and comfort.

a perfect blend of style and comfort. This fitted crop top is designed to enhance your silhouette, while the front features the distinctive Rastah artwork logo patch. Key Features: Soft baby cotton fabric Fitted shape for a flattering silhouette Front Rastah artwork logo patch Model Information: Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Soft baby cotton fabric
  • Fitted shape for a flattering silhouette
  • Front Rastah artwork logo patch
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
JULY CAPSULE 24
SKU RADIANTHORIZONBABYBLUECROPTOP-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
"Retro cruising" jersey shirt

T-Shirt

"Retro cruising" jersey shirt

A nod to '90s hip-hop fashion.

A nod to '90s hip-hop fashion. Crafted entirely from 100% polyester, this jersey embraces a classic striped pattern in various grey hues reminiscent of the popular '90s jerseys often donned by hip-hop artists of the past. Its elegant and subtle graphic on the back, featuring a vintage car, adds a touch of timeless charm. Technical Specifications: 100% polyester construction 90's jersey-style pattern Vintage-style graphic on back Care Instructions: Machine wash on a gentle cycle. Use mild detergent. Tumble dry on low heat. Do not iron or dry clean. Male Model Information: Height: 5'10" Weight: 150 lbs Size Worn: Medium Female Model Information: Height: 5'5" Weight: 110 lbs Size Worn: Small AVAILABILITY: Products will be launched for purchase on December 28th, with shipping commencing from January 18th.

  • 100% polyester construction
  • 90's jersey-style pattern
  • Vintage-style graphic on back
  • Machine wash on a gentle cycle.
  • Use mild detergent.
  • Tumble dry on low heat.
  • Do not iron or dry clean.
  • Height: 5'10"
  • Weight: 150 lbs
  • Size Worn: Medium
  • Height: 5'5"
  • Weight: 110 lbs
Product type
T-Shirt
Vendor
INTERMISSION 9
SKU RETROCRUISINGJERSEYSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 141

Currently unavailable

View in 3DFull listing
"Retro cruising" jersey shirt

T-Shirt

"Retro cruising" jersey shirt

A nod to '90s hip-hop fashion.

A nod to '90s hip-hop fashion. Crafted entirely from 100% polyester, this jersey embraces a classic striped pattern in various grey hues reminiscent of the popular '90s jerseys often donned by hip-hop artists of the past. Its elegant and subtle graphic on the back, featuring a vintage car, adds a touch of timeless charm. Technical Specifications: 100% polyester construction 90's jersey-style pattern Vintage-style graphic on back Care Instructions: Machine wash on a gentle cycle. Use mild detergent. Tumble dry on low heat. Do not iron or dry clean. Male Model Information: Height: 5'10" Weight: 150 lbs Size Worn: Medium Female Model Information: Height: 5'5" Weight: 110 lbs Size Worn: Small AVAILABILITY: Products will be launched for purchase on December 28th, with shipping commencing from January 18th.

  • 100% polyester construction
  • 90's jersey-style pattern
  • Vintage-style graphic on back
  • Machine wash on a gentle cycle.
  • Use mild detergent.
  • Tumble dry on low heat.
  • Do not iron or dry clean.
  • Height: 5'10"
  • Weight: 150 lbs
  • Size Worn: Medium
  • Height: 5'5"
  • Weight: 110 lbs
Product type
T-Shirt
Vendor
INTERMISSION 9
SKU RETROCRUISINGJERSEYSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 141

Currently unavailable

View in 3DFull listing
"Sarzameen ki zubaan" T-shirt

T-Shirt

"Sarzameen ki zubaan" T-shirt

A soft cream-toned t-shirt featuring an expressive hand-drawn graphic printed on the back.

A soft cream-toned t-shirt featuring an expressive hand-drawn graphic printed on the back. The artwork blends traditional South Asian motifs with contemporary design sensibility. The green elements in the artwork are highlighted with puff print, adding tactile dimension to the shirt, while the rest of the graphic is executed in screen print. A subtle Urdu calligraphy logo is screen-printed on the front chest, maintaining a balanced minimalism from the front view. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: 100% cotton terry for breathable comfort Oversized fit with dropped shoulders Multicolour back graphic with puff print accents Front chest logo with screen print in Urdu script Durable stitching and soft hand-feel Care Instructions: Dry clean only

  • 100% cotton terry for breathable comfort
  • Oversized fit with dropped shoulders
  • Multicolour back graphic with puff print accents
  • Front chest logo with screen print in Urdu script
  • Durable stitching and soft hand-feel
  • Dry clean only
Product type
T-Shirt
Vendor
Songs of the Desert
SKU SARZAMEENKIZUBAANT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
"Script echoes" T-shirt

T-Shirt

"Script echoes" T-shirt

The "Script Echoes" Artisan Tee is an exclusive masterpiece for our cherished loyal customers, blending contemporary style with profound artistic expression.

The "Script Echoes" Artisan Tee is an exclusive masterpiece for our cherished loyal customers, blending contemporary style with profound artistic expression. Crafted from premium, soft 100% terry cotton, its unique washed-out hue sets the stage for the striking screen-printed design. Vibrant green and yellow strokes evoke reimagined Arabic calligraphy, creating a wearable piece of art that signifies your valued loyalty. Please note: Due to its unique craftsmanship, the final size of this product may vary by up to 0.5 inches (1.27 cm) more or less. Actual product colors may also vary slightly from the images shown due to photographic lighting or monitor settings. Key Features: Premium Terry Cotton: 100% high-quality, soft, and breathable. Artistic Screen Print: Captivating modern abstract art with Arabic script. Unique Washed Finish: Distinctive vintage aesthetic. Relaxed Fit: Comfortable and effortlessly stylish. Exclusive Loyalty Offering: Limited-edition item for valued clientele. Durable: Ensures lasting wear and vibrant colors. Care Instructions: Dry clean only

  • Premium Terry Cotton: 100% high-quality, soft, and breathable.
  • Artistic Screen Print: Captivating modern abstract art with Arabic script.
  • Unique Washed Finish: Distinctive vintage aesthetic.
  • Relaxed Fit: Comfortable and effortlessly stylish.
  • Exclusive Loyalty Offering: Limited-edition item for valued clientele.
  • Durable: Ensures lasting wear and vibrant colors.
Product type
T-Shirt
Vendor
enclave exclusive
SKU SCRIPTECHOEST-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 176

Currently unavailable

View in 3DFull listing
"Shapeshifter" block print T-shirt

T-Shirt

"Shapeshifter" block print T-shirt

Introducing our "Shapeshifter Block Print" T-Shirt, a perfect fusion of tradition and contemporary style.

Introducing our "Shapeshifter Block Print" T-Shirt, a perfect fusion of tradition and contemporary style. This olive green t-shirt, made from 100% cotton with a fabric weight of 220 GSM, offers unmatched comfort and durability. The oversized fit ensures a relaxed and stylish look, while the hand block printed geometric design adds a unique and artistic touch to the garment. Key Features: 100% cotton fabric for breathability and comfort 220 GSM for a premium, substantial feel Oversized fit for a trendy, relaxed style Hand block printed geometric design for a unique and artistic look Olive green color for a versatile and natural aesthetic Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on medium heat if needed Do not dry clean

  • 100% cotton fabric for breathability and comfort
  • 220 GSM for a premium, substantial feel
  • Oversized fit for a trendy, relaxed style
  • Hand block printed geometric design for a unique and artistic look
  • Olive green color for a versatile and natural aesthetic
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on medium heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
MAY CAPSULE 24
SKU SHAPESHIFTERBLOCKPRINTTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 176

Currently unavailable

View in 3DFull listing
"Summer green" garment dyed logo T-shirt

T-Shirt

"Summer green" garment dyed logo T-shirt

Rastah logo t-shirt with a newly designed limited edition logo.

Rastah logo t-shirt with a newly designed limited edition logo. Each piece is garment dyed using a unique pigment dyeing technique that gives the piece a slightly faded vintage look. The garment is constructed from soft midweight terry fabric made to order to Rastah's specification and fits oversized. This is a true collectible piece with its dye formulation and logo design, and will never be reproduced again. *THIS COLLECTION GOES LIVE ON THE 21ST OF MARCH AND WILL SHIP OUT FROM THE 30TH OF MARCH* *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit Garment dyed using a pigment wash technique for a faded vintage look Rastah March'23 limited edition logo screen printed 80% cotton and 20% polyester midweight terry fabric Washing/Handling: Hand wash with cold water inside out & hang to dry Male model is 5'10 150 lbs and wears size medium

  • slightly oversized fit
  • Garment dyed using a pigment wash technique for a faded vintage look
  • Rastah March'23 limited edition logo screen printed
  • 80% cotton and 20% polyester midweight terry fabric
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male model is 5'10 150 lbs and wears size medium
Product type
T-Shirt
Vendor
MARCH DELIVERY
Compare at
PKR 62
SKU SUMMERGREENGARMENTDYEDLOGOTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 62

Currently unavailable

View in 3DFull listing
"Sweet lemonade" garment dyed logo T-shirt

T-Shirt

"Sweet lemonade" garment dyed logo T-shirt

Rastah logo t-shirt with a newly designed limited edition logo.

Rastah logo t-shirt with a newly designed limited edition logo. Each piece is garment dyed using a unique pigment dyeing technique that gives the piece a slightly faded vintage look. The garment is constructed from soft midweight terry fabric made to order to Rastah's specification and fits oversized. This is a true collectible piece with its dye formulation and logo design, and will never be reproduced again. *THIS COLLECTION GOES LIVE ON THE 21ST OF MARCH AND WILL SHIP OUT FROM THE 30TH OF MARCH* *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit Garment dyed using a pigment wash technique for a faded vintage look Rastah March'23 limited edition logo screen printed 80% cotton and 20% polyester midweight terry fabric Washing/Handling: Hand wash with cold water inside out & hang to dry Male model is 5'10 150 lbs and wears size medium

  • slightly oversized fit
  • Garment dyed using a pigment wash technique for a faded vintage look
  • Rastah March'23 limited edition logo screen printed
  • 80% cotton and 20% polyester midweight terry fabric
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male model is 5'10 150 lbs and wears size medium
Product type
T-Shirt
Vendor
MARCH DELIVERY
Compare at
PKR 62
SKU SWEETLEMONADEGARMENTDYEDLOGOTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 62

Currently unavailable

View in 3DFull listing
"The gaze" patchwork T-shirt

T-Shirt

"The gaze" patchwork T-shirt

Crafted from premium terry 100% cotton, this black t-shirt is a canvas of intricate tradition and experimental design.

Crafted from premium terry 100% cotton, this black t-shirt is a canvas of intricate tradition and experimental design. Featuring hand-applied blockprint patches on contrasting black khaddar and white cotton fabrics, it highlights a majestic embroidered peacock motif alongside a screen-printed Rastah logo at the center. Raw hems and sleeves give the shirt a worn, deconstructed edge—channeling quiet rebellion through traditional craft. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: Fabric: 100% Cotton Terry Patchwork details in black khaddar & white cotton with block printing Hand embroidery (peacock + traditional motifs) Screen-printed Rastah logo on front Raw edges on sleeves and hem Relaxed, boxy silhouette Care Instructions: Dry clean only

  • Fabric: 100% Cotton Terry
  • Patchwork details in black khaddar & white cotton with block printing
  • Hand embroidery (peacock + traditional motifs)
  • Screen-printed Rastah logo on front
  • Raw edges on sleeves and hem
  • Relaxed, boxy silhouette
  • Dry clean only
Product type
T-Shirt
Vendor
Songs of the Desert
SKU THEGAZEPATCHWORKT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
"The introspective vampire" sea green T-shirt

T-Shirt

"The introspective vampire" sea green T-shirt

The "Introspective Vampire" T-Shirt is a companion piece to the "Introspective Vampire" sweatpants.

The "Introspective Vampire" T-Shirt is a companion piece to the "Introspective Vampire" sweatpants. Looks can be deceiving: they don't bite, and are super cozy. They may, however, cause you to introspect, but who doesn't like that? 400 GSM Fleece Digital Print Rastah Volume IX Logo Regular fit Washing/Handling: hand wash with cold water and hang to dry Male model 5'10 and 150 lbs wearing medium , female model 5'8 wearing small

  • 400 GSM Fleece
  • Digital Print
  • Rastah Volume IX Logo
  • Regular fit
  • Washing/Handling: hand wash with cold water and hang to dry
  • Male model 5'10 and 150 lbs wearing medium , female model 5'8 wearing small
Product type
T-Shirt
Vendor
VOLUME IX
Compare at
PKR 88
SKU THEINTROSPECTIVEVAMPIRESEAGREENT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 53

Currently unavailable

View in 3DFull listing
"The world is yours" T-shirt

T-Shirt

"The world is yours" T-shirt

This 220 GSM Cotton T-shirt—celebrates the glitz of the '90s film era.

This 220 GSM Cotton T-shirt—celebrates the glitz of the '90s film era. This 80% cotton/20% polyester t-shirt embraces Urdu typography on the back, featuring the empowering phrase 'The World is Yours,' complemented by a graphic inspired by the opulent aesthetics of the glamorous '90s film era. On the front, it proudly showcases the iconic Intermission 9 logo, seamlessly incorporating a microphone into the typography. Technical Specifications: 80% cotton 20% polyester with a weight of 220 gsm for comfort and durability. Urdu typography and graphic on the back. Iconic Intermission 9 logo Care Instructions: Machine wash cold with like colors. Use a mild detergent. Tumble dry on low heat or air dry to preserve the fabric. Avoid ironing directly on the print or using bleach. Male Model Information: Height: 5'10" Weight: 150 lbs Size Worn: Medium Female Model Information: Height: 5'5" Weight: 110 lbs Size Worn: Small AVAILABILITY: Products will be launched for purchase on December 28th, with shipping commencing from January 18th.

  • 80% cotton 20% polyester with a weight of 220 gsm for comfort and durability.
  • Urdu typography and graphic on the back.
  • Iconic Intermission 9 logo
  • Machine wash cold with like colors.
  • Use a mild detergent.
  • Tumble dry on low heat or air dry to preserve the fabric.
  • Avoid ironing directly on the print or using bleach.
  • Height: 5'10"
  • Weight: 150 lbs
  • Size Worn: Medium
  • Height: 5'5"
  • Weight: 110 lbs
Product type
T-Shirt
Vendor
INTERMISSION 9
SKU THEWORLDISYOURST-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"These kids" screen print black T-shirt

T-Shirt

"These kids" screen print black T-shirt

Crafted from midweight 270gsm cotton terry, this black tee boasts a comfortable, oversized fit for ultimate relaxation.

Crafted from midweight 270gsm cotton terry, this black tee boasts a comfortable, oversized fit for ultimate relaxation. Inspired by the iconic Offspring song "These Kids Are Not Alright," the front features a striking graffiti design with Urdu script reading the song name and lyrics printed on top of a punk character with Rastah tattoos on his head and arm. The back has the rastah logo as a patch. Midweight 270gsm cotton terry for supreme comfort Oversized fit for relaxed style Striking graffiti design inspired by Offspring song "These Kids Are Not Alright" Urdu script printing of the song name and lyrics Male model 5'11 wearing medium, female model 5'8 wearing medium Available for purchase on the 25th of April, with shipping starting on the 27th.

  • Midweight 270gsm cotton terry for supreme comfort
  • Oversized fit for relaxed style
  • Striking graffiti design inspired by Offspring song "These Kids Are Not Alright"
  • Urdu script printing of the song name and lyrics
  • Male model 5'11 wearing medium, female model 5'8 wearing medium
Product type
T-Shirt
Vendor
APRIL CAPSULE 23
Compare at
PKR 88
SKU THESEKIDSSCREENPRINTBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"These kids" screen print black T-shirt

T-Shirt

"These kids" screen print black T-shirt

Crafted from midweight 270gsm cotton terry, this black tee boasts a comfortable, oversized fit for ultimate relaxation.

Crafted from midweight 270gsm cotton terry, this black tee boasts a comfortable, oversized fit for ultimate relaxation. Inspired by the iconic Offspring song "These Kids Are Not Alright," the front features a striking graffiti design with Urdu script reading the song name and lyrics printed on top of a punk character with Rastah tattoos on his head and arm. The back has the rastah logo as a patch. Midweight 270gsm cotton terry for supreme comfort Oversized fit for relaxed style Striking graffiti design inspired by Offspring song "These Kids Are Not Alright" Urdu script printing of the song name and lyrics Male model 5'11 wearing medium, female model 5'8 wearing medium Available for purchase on the 25th of April, with shipping starting on the 27th.

  • Midweight 270gsm cotton terry for supreme comfort
  • Oversized fit for relaxed style
  • Striking graffiti design inspired by Offspring song "These Kids Are Not Alright"
  • Urdu script printing of the song name and lyrics
  • Male model 5'11 wearing medium, female model 5'8 wearing medium
Product type
T-Shirt
Vendor
APRIL CAPSULE 23
Compare at
PKR 88
SKU THESEKIDSSCREENPRINTBLACKTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Thug life" T-shirt

T-Shirt

"Thug life" T-shirt

A tribute to Tupac's legacy.

A tribute to Tupac's legacy. This 100% cotton t-shirt commemorates the memory of Tupac Shakur, showcasing 'Thug Life' in Urdu typography on the back. The graphic depicts Tupac adorned with a chain featuring the letter 'R,' symbolizing Rastah's homage to the iconic artist. The shirt also features the Intermission 9 logo with a microphone motif on the front. Technical Specifications: 100% cotton with a weight of 230 gsm for enhanced comfort and quality. 'Thug Life' in Urdu typography and Tupac-inspired graphic on the back. Intermission 9 logo on the front Care Instructions: Machine wash cold with like colors. Use a mild detergent. Tumble dry on low heat or air dry to maintain fabric integrity. Avoid direct ironing on the print and refrain from using bleach. Male Model Information: Height: 5'10" Weight: 150 lbs Size Worn: Medium Female Model Information: Height: 5'5" Weight: 110 lbs Size Worn: Small AVAILABILITY: Products will be launched for purchase on December 28th, with shipping commencing from January 18th.

  • 100% cotton with a weight of 230 gsm for enhanced comfort and quality.
  • 'Thug Life' in Urdu typography and Tupac-inspired graphic on the back.
  • Intermission 9 logo on the front
  • Machine wash cold with like colors.
  • Use a mild detergent.
  • Tumble dry on low heat or air dry to maintain fabric integrity.
  • Avoid direct ironing on the print and refrain from using bleach.
  • Height: 5'10"
  • Weight: 150 lbs
  • Size Worn: Medium
  • Height: 5'5"
  • Weight: 110 lbs
Product type
T-Shirt
Vendor
INTERMISSION 9
SKU THUGLIFET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Thug life" T-shirt

T-Shirt

"Thug life" T-shirt

A tribute to Tupac's legacy.

A tribute to Tupac's legacy. This 100% cotton t-shirt commemorates the memory of Tupac Shakur, showcasing 'Thug Life' in Urdu typography on the back. The graphic depicts Tupac adorned with a chain featuring the letter 'R,' symbolizing Rastah's homage to the iconic artist. The shirt also features the Intermission 9 logo with a microphone motif on the front. Technical Specifications: 100% cotton with a weight of 230 gsm for enhanced comfort and quality. 'Thug Life' in Urdu typography and Tupac-inspired graphic on the back. Intermission 9 logo on the front Care Instructions: Machine wash cold with like colors. Use a mild detergent. Tumble dry on low heat or air dry to maintain fabric integrity. Avoid direct ironing on the print and refrain from using bleach. Male Model Information: Height: 5'10" Weight: 150 lbs Size Worn: Medium Female Model Information: Height: 5'5" Weight: 110 lbs Size Worn: Small AVAILABILITY: Products will be launched for purchase on December 28th, with shipping commencing from January 18th.

  • 100% cotton with a weight of 230 gsm for enhanced comfort and quality.
  • 'Thug Life' in Urdu typography and Tupac-inspired graphic on the back.
  • Intermission 9 logo on the front
  • Machine wash cold with like colors.
  • Use a mild detergent.
  • Tumble dry on low heat or air dry to maintain fabric integrity.
  • Avoid direct ironing on the print and refrain from using bleach.
  • Height: 5'10"
  • Weight: 150 lbs
  • Size Worn: Medium
  • Height: 5'5"
  • Weight: 110 lbs
Product type
T-Shirt
Vendor
INTERMISSION 9
SKU THUGLIFET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Tot batoot" T-shirt

T-Shirt

"Tot batoot" T-shirt

The Safar-e-Del "Tot Batoot" Tee in rich maroon weaves a tale of wonder and wisdom.

The Safar-e-Del "Tot Batoot" Tee in rich maroon weaves a tale of wonder and wisdom. Inspired by Sufi Ghulam Mustafa Tabassum's "Tot Batoot" poem, its back features a stunning sublimation print on silk with a Mughal miniature-style frame . This oversized, comfortable tee is a wearable masterpiece, connecting you to beloved poetry and timeless art. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: Deep Maroon Hue: Elegant and evocative. Artistic Back Panel: Silk patch with "Tot Batoot" poem and illustration, framed by intricate Mughal miniature art. Premium Comfort: Soft, breathable, oversized fit. Cultural Homage: Direct reference to Sufi Ghulam Mustafa Tabassum's iconic poem. Care Instructions: Dry clean only

  • Deep Maroon Hue: Elegant and evocative.
  • Artistic Back Panel: Silk patch with "Tot Batoot" poem and illustration, framed by intricate Mughal miniature art.
  • Premium Comfort: Soft, breathable, oversized fit.
  • Cultural Homage: Direct reference to Sufi Ghulam Mustafa Tabassum's iconic poem.
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU TOTBATOOTT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
"Vase of life" hand block printed T-shirt

T-Shirt

"Vase of life" hand block printed T-shirt

an ode to traditional craftsmanship and timeless artistry.

an ode to traditional craftsmanship and timeless artistry. This t-shirt, block printed by Rastah's partner artisan Mr. Aslam, a fourth-generation block printer, showcases the intricate beauty of hand-carved wooden blocks. Each piece is meticulously printed by hand, ensuring a unique and personal touch to every shirt. Key Features: Premium cotton fabric Block printed by hand Front logo patch Unique design by fourth-generation artisan Craftsmanship: This t-shirt is block printed by Mr. Aslam, who brings a rich heritage and unparalleled skill to each piece. Using hand-carved wooden blocks, he imprints intricate patterns onto the fabric, making each t-shirt a one-of-a-kind work of art. Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Premium cotton fabric
  • Block printed by hand
  • Front logo patch
  • Unique design by fourth-generation artisan
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
JULY CAPSULE 24
SKU VASEOFLIFEHANDBLOCKPRINTEDTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 141

Currently unavailable

View in 3DFull listing
"You and I" screen print blue T-shirt

T-Shirt

"You and I" screen print blue T-shirt

With a design that cleverly interprets the beauty of companionship, this t-shirt is a vibrant illustration of the play of life.

With a design that cleverly interprets the beauty of companionship, this t-shirt is a vibrant illustration of the play of life. The back print, translating to "You and I Make a Circus" in Urdu, presents a vivid picture of puppeteer hands above a circus tent, interspersed with an overlay of playing cards. An artistic blend of symbolism and statement, this piece reflects the lively game of life, and the undeniable power of togetherness in making it a beautiful spectacle. Product Specs: Material: 100% compact combed cotton GSM: 230 Fit: Oversized Color: Black Model Info: Male Model: 5'11, wearing a size Medium Female Model: 5'6, wearing a size Small Washing Instructions: Hand wash with cold water and hang to dry. Or machine wash in cold water and dry on low heat. This piece will be available for purchase on the 25th of July, with shipping commencing on the 28th of July.

  • Material: 100% compact combed cotton
  • GSM: 230
  • Fit: Oversized
  • Color: Black
  • Male Model: 5'11, wearing a size Medium
  • Female Model: 5'6, wearing a size Small
Product type
T-Shirt
Vendor
Rastah
SKU YOUANDISCREENPRINTBLUETSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
"Zakhira-E-Ruh" T-shirt

T-Shirt

"Zakhira-E-Ruh" T-shirt

A bold navy tee featuring a vibrant alien graphic that reads “Your Soul is Mine” in English and Urdu.

A bold navy tee featuring a vibrant alien graphic that reads “Your Soul is Mine” in English and Urdu. Crafted in 100% cotton terry with 220 GSM, it delivers a structured yet breathable feel. This design bridges cosmic fantasy with pop rebellion and desi streetwear attitude. Key Features: 100% cotton terry (220 GSM) Screen-printed graphic on the back Urdu + English typography blend Ribbed neckline and drop shoulders for relaxed silhouette Care Instructions: Dry clean only

  • 100% cotton terry (220 GSM)
  • Screen-printed graphic on the back
  • Urdu + English typography blend
  • Ribbed neckline and drop shoulders for relaxed silhouette
  • Dry clean only
Product type
T-Shirt
Vendor
UNLUCKY CHARMS
SKU ZAKHIRA-E-RUHTSHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 119

Currently unavailable

View in 3DFull listing
Aasteen ka saanp full-sleeve T-shirt

T-Shirt

Aasteen ka saanp full-sleeve T-shirt

This maroon full-sleeve t-shirt features a bold screen-printed graphic of a snake and pixel-style typography.

This maroon full-sleeve t-shirt features a bold screen-printed graphic of a snake and pixel-style typography. Crafted from 100% cotton terry with a soft hand feel and 220 GSM weight, it delivers comfort and playful nostalgia. A relaxed silhouette with a streetwear edge. Key Features Material: 100% cotton terry Fabric Weight: 220 GSM Full-sleeve design with crew neck Screen-printed front and back artwork Relaxed, boxy fit Care Instructions Dry clean only

  • Material: 100% cotton terry
  • Fabric Weight: 220 GSM
  • Full-sleeve design with crew neck
  • Screen-printed front and back artwork
  • Relaxed, boxy fit
  • Dry clean only
Product type
T-Shirt
Vendor
UNLUCKY CHARMS
SKU AASTEENKASAANPFULLSLEEVETSHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
Abstract postage stamp T-shirt

T-Shirt

Abstract postage stamp T-shirt

The garment is hand screen printed and inspired by sports themed postage stamps from the 1980's.

The garment is hand screen printed and inspired by sports themed postage stamps from the 1980's. A very limited number of pieces have been printed in this design. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah INTERMISSION IV monogram screen printed on front hand screen printed artwork on the back Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah INTERMISSION IV monogram screen printed on front
  • hand screen printed artwork on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
INTERMISSION 4
Compare at
PKR 79
SKU ABSTRACTPOSTAGESTAMPT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Acid charcoal made in PAK T-shirt (V5)

T-Shirt

Acid charcoal made in PAK T-shirt (V5)

Product Description: An oversized t-shirt crafted from 100% cotton jersey fabric in an Ashen Grey tone.

Product Description: An oversized t-shirt crafted from 100% cotton jersey fabric in an Ashen Grey tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton jersey Color: Ashen Grey Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton jersey
  • Color: Ashen Grey
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU ACIDCHARCOALMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 84

In stock · ready to checkout

View in 3DBuy nowFull listing
Acid wash graffiti tank top

T-Shirt

Acid wash graffiti tank top

Made from 270gsm cotton, this tank top boasts a unique acid wash finish for a vintage vibe.

Made from 270gsm cotton, this tank top boasts a unique acid wash finish for a vintage vibe. The blown-out Rastah logo in graffiti style on the front merges the Urdu and English versions together, creating a bold and distinctive look. 270gsm cotton for supreme comfort Acid wash finish for a vintage vibe Blown-out Rastah logo in graffiti style on the front Merged Urdu and English versions of the logo Male model 5'11 wears medium, female model 5'8 wearing medium Available for purchase on the 25th of April, with shipping starting on the 27th.

  • 270gsm cotton for supreme comfort
  • Acid wash finish for a vintage vibe
  • Blown-out Rastah logo in graffiti style on the front
  • Merged Urdu and English versions of the logo
  • Male model 5'11 wears medium, female model 5'8 wearing medium
Product type
T-Shirt
Vendor
APRIL CAPSULE 23
Compare at
PKR 71
SKU ACIDWASHGRAFFITITANKTOP-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 71

Currently unavailable

View in 3DFull listing
Acid wash graffiti tank top

T-Shirt

Acid wash graffiti tank top

Made from 270gsm cotton, this tank top boasts a unique acid wash finish for a vintage vibe.

Made from 270gsm cotton, this tank top boasts a unique acid wash finish for a vintage vibe. The blown-out Rastah logo in graffiti style on the front merges the Urdu and English versions together, creating a bold and distinctive look. 270gsm cotton for supreme comfort Acid wash finish for a vintage vibe Blown-out Rastah logo in graffiti style on the front Merged Urdu and English versions of the logo Male model 5'11 wears medium, female model 5'8 wearing medium Available for purchase on the 25th of April, with shipping starting on the 27th.

  • 270gsm cotton for supreme comfort
  • Acid wash finish for a vintage vibe
  • Blown-out Rastah logo in graffiti style on the front
  • Merged Urdu and English versions of the logo
  • Male model 5'11 wears medium, female model 5'8 wearing medium
Product type
T-Shirt
Vendor
APRIL CAPSULE 23
Compare at
PKR 71
SKU ACIDWASHGRAFFITITANKTOP-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 71

Currently unavailable

View in 3DFull listing
Acid wash logo T-shirt

T-Shirt

Acid wash logo T-shirt

Rastah logo t-shirt with Rastah Volume V monogram screen printed on a midweight acid washed t shirt.

Rastah logo t-shirt with Rastah Volume V monogram screen printed on a midweight acid washed t shirt. A staple piece for any occasion, and any season. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah Volume V monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6'1 ; wearing: Medium

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah Volume V monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6'1 ; wearing: Medium
Product type
T-Shirt
Vendor
VOLUME V
SKU ACIDWASHLOGOT-SHRIT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 53

Currently unavailable

View in 3DFull listing
Aiza ahmed collab T-shirt

T-Shirt

Aiza ahmed collab T-shirt

This handcrafted shirt delves into the notion of growing up as a Pakistani woman in the East and the West and how one is often forced to play a balancing act between the cultures.

This handcrafted shirt delves into the notion of growing up as a Pakistani woman in the East and the West and how one is often forced to play a balancing act between the cultures. Female empowerment, defying societal norms, elevating the female symbol and the intersection between the traditional and unconventional are also among the themes explored in the piece. With this in mind, Aiza Ahmed draws a female figure in traditional clothing smoking, something that is typically frowned upon in eastern cultures particularly for women, just to highlight the dichotomy. The design on the back of the shirt exudes a magical aura, portraying a queen in a royal throne, surrounded by lavishness, flora and fauna. Ahmed reflects upon the dreams young girls often have growing up, longing for recognition, respect and acceptance. The aesthetic is an amalgamation of figuration, minimalism and abstraction, treading the fine line between simplicity and complexity. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah Volume V monogram screen printed on front hand screen printed artwork on front and back Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6'1 ; wearing: Medium | Female Model: 5'7; Wearing small

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah Volume V monogram screen printed on front
  • hand screen printed artwork on front and back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6'1 ; wearing: Medium | Female Model: 5'7; Wearing small
Product type
T-Shirt
Vendor
VOLUME V
SKU AIZAAHMEDCOLLABT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Ajrak handwoven T-shirt

T-Shirt

Ajrak handwoven T-shirt

Ajrak Block Print Black Shirt – Signature Collection This black handwoven khaddar shirt is a true ode to heritage craftsmanship, featuring intricate Ajrak-inspi

Ajrak Block Print Black Shirt – Signature Collection This black handwoven khaddar shirt is a true ode to heritage craftsmanship, featuring intricate Ajrak-inspired block printing that fuses centuries-old artistry with a contemporary edge. The rich patterns, carefully placed on the back panel and sleeve cuffs, reflect the depth of Pakistani culture, while the muted maroon contrast collar and sleeve bands add a modern, fashion-forward twist. Designed for a relaxed fit with subtle structure, this piece offers a versatile look, whether layered or worn on its own. It’s an effortless blend of tradition and style, perfect for any wardrobe. 🌟 Key Features Handwoven khaddar fabric for natural breathability Ajrak-inspired block print design on back and sleeves Muted maroon contrast neckline and sleeve details Relaxed fit with subtle tailoring Heritage-inspired patterns reimagined for contemporary fashion 🧵 Care Instructions Dry clean for best results Iron on low heat if needed, avoiding printed areas Store flat or on hanger to maintain shape

  • Handwoven khaddar fabric for natural breathability
  • Ajrak-inspired block print design on back and sleeves
  • Muted maroon contrast neckline and sleeve details
  • Relaxed fit with subtle tailoring
  • Heritage-inspired patterns reimagined for contemporary fashion
  • Dry clean for best results
  • Iron on low heat if needed, avoiding printed areas
  • Store flat or on hanger to maintain shape
Product type
T-Shirt
Vendor
Ajrak Drop
SKU AJRAKHANDWOVENTSHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 202

Currently unavailable

View in 3DFull listing
Alyan tareen "falling faces" collab T-shirt

T-Shirt

Alyan tareen "falling faces" collab T-shirt

Traditional hand screen printed t shirt with Rastah Volume V monogram on the front.

Traditional hand screen printed t shirt with Rastah Volume V monogram on the front. The back of the design is an in house illustration by Rastah's very own Alyan Khan Tareen. The design explores questions of identity, existentialism and love. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah Volume V monogram screen printed on front hand screen printed artwork on the back Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6'1 ; wearing: Medium | Female Model: 5'7; Wearing small

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah Volume V monogram screen printed on front
  • hand screen printed artwork on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6'1 ; wearing: Medium | Female Model: 5'7; Wearing small
Product type
T-Shirt
Vendor
VOLUME V
SKU ALYANTAREENFALLINGFACESCOLLABT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Angan T-Shirt

T-Shirt

Angan T-Shirt

Angan means courtyard — the open centre of a South Asian home where everything converges.

Angan means courtyard — the open centre of a South Asian home where everything converges. Morning chai, afternoon conversations, evening light falling at the right angle. This tee is built around that same idea: multiple worlds meeting at a single point. On a black jersey base, the Angan T-Shirt layers technique upon technique. The front carries a screen-printed RASTAH logo, hand-woven fabric patches, and silk-jacquard inserts that catch light differently depending on how you move. The back runs a full screen-print composition. A jute sublimation patch sits on the body alongside block-printed khaddar sections — each material chosen for what it contributes to the whole. Black here is not minimalism. It is the backdrop that makes everything else visible — the way a courtyard wall frames whatever happens in front of it. Every technique on this shirt has its own craft lineage: jacquard weaving, hand-loom construction, block printing, sublimation on jute. Assembled together they create a surface that reads differently at different distances. RASTAH builds collections as stories. The angan is where those stories get told — surrounded, held, witnessed. Wear this shirt as that space: the place where things come together. Key Features Black jersey construction Screen-printed RASTAH logo at front Hand-woven fabric patches at front Silk-jacquard inset panels Block-printed khaddar patches Jute sublimation patch Screen-printed back artwork Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Black jersey construction
  • Screen-printed RASTAH logo at front
  • Hand-woven fabric patches at front
  • Silk-jacquard inset panels
  • Block-printed khaddar patches
  • Jute sublimation patch
  • Screen-printed back artwork
Product type
T-Shirt
Vendor
Dastkari
SKU ANGANT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 115

In stock · ready to checkout

View in 3DBuy nowFull listing
Apocalypse cat T-shirt

T-Shirt

Apocalypse cat T-shirt

A bold visual statement featuring a surreal green cat and apocalyptic Urdu slogans.

A bold visual statement featuring a surreal green cat and apocalyptic Urdu slogans. Crafted from 100% cotton with a relaxed, oversized fit for everyday rebellion. Where streetwear meets satire — chaos never looked this composed. Key Features: Oversized fit for comfort and edge 220 GSM 100% cotton terry High-contrast, multicolor screen print on back Urdu and English text elements Surreal “apocalypse cat” motif Front left chest logo in green Urdu script Care Instructions: Dry clean only

  • Oversized fit for comfort and edge
  • 220 GSM 100% cotton terry
  • High-contrast, multicolor screen print on back
  • Urdu and English text elements
  • Surreal “apocalypse cat” motif
  • Front left chest logo in green Urdu script
  • Dry clean only
Product type
T-Shirt
Vendor
UNLUCKY CHARMS
SKU APOCALYPSECATT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 119

Currently unavailable

View in 3DFull listing
Ash lightweight T-shirt

T-Shirt

Ash lightweight T-shirt

The Raakh Tee channels subtle sophistication through fine construction and tactile depth.

The Raakh Tee channels subtle sophistication through fine construction and tactile depth. Made from soft cotton shembarray fabric , this t-shirt showcases vertical slub textures in a cool ash-grey tone. The body is cut in a relaxed, boxy silhouette that drapes naturally, with black khaddar contrast ribbing on the neckline and sleeve cuffs for tonal structure. A Rastah logo patch in white embroidery on black grounds the design in the brand’s identity—discreet yet powerful. Key Features Fabric : Lightweight cotton shembarray Color : Ash grey with black accents Trim : Ribbed khaddar neckline and sleeve cuffs Logo : Embroidered Rastah patch on chest Fit : Boxy, relaxed silhouette Care Instructions Dry clean only

  • Fabric : Lightweight cotton shembarray
  • Color : Ash grey with black accents
  • Trim : Ribbed khaddar neckline and sleeve cuffs
  • Logo : Embroidered Rastah patch on chest
  • Fit : Boxy, relaxed silhouette
  • Dry clean only
Product type
T-Shirt
Vendor
EMERALD DREAMS
SKU ASHLIGHTWEIGHTT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
Azure Acid Wash made in PAK T-shirt (V6)

T-Shirt

Azure Acid Wash made in PAK T-shirt (V6)

Crafted from soft jersey fabric, the MIP Tee is finished with an azure acid wash treatment for a distinctive worn-in look.

Crafted from soft jersey fabric, the MIP Tee is finished with an azure acid wash treatment for a distinctive worn-in look. A statement screen-printed graphic on the back adds visual impact, while the relaxed silhouette ensures everyday comfort and versatility. Features Soft jersey construction Azure acid wash finish Screen-printed back graphic Classic crew neckline Relaxed fit Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Do not iron directly on print Wash with similar colors

  • Soft jersey construction
  • Azure acid wash finish
  • Screen-printed back graphic
  • Classic crew neckline
  • Relaxed fit
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Do not iron directly on print
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU RASTAH-10783802392888

Sizes / variants: XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 101

Currently unavailable

View in 3DFull listing
Azure made in PAK T-shirt (V2)

T-Shirt

Azure made in PAK T-shirt (V2)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. Crafted with meticulous detail, this T-shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back. Constructed from 220 GSM acid washed cotton terry fabric, this shirt boasts an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front Acid-washed for a unique look "Made in Pakistan" in Urdu typography on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • Acid-washed for a unique look
  • "Made in Pakistan" in Urdu typography on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU AZUREMADEINPAKT-SHIRT(V2)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Azure made in PAK T-shirt (V2)

T-Shirt

Azure made in PAK T-shirt (V2)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. Crafted with meticulous detail, this T-shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back. Constructed from 220 GSM acid washed cotton terry fabric, this shirt boasts an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front Acid-washed for a unique look "Made in Pakistan" in Urdu typography on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • Acid-washed for a unique look
  • "Made in Pakistan" in Urdu typography on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
RESTOCK
SKU AZUREMADEINPAKT-SHIRT(V2)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Azure made in Pak Tshirt V6

T-Shirt

Azure made in Pak Tshirt V6

The Made in Pakistan Acid Wash Tee – Azure Grey combines vintage-inspired wash effects with contemporary streetwear design.

The Made in Pakistan Acid Wash Tee – Azure Grey combines vintage-inspired wash effects with contemporary streetwear design. Crafted from premium cotton and finished with a unique acid-wash treatment, each piece carries its own distinctive character. Featuring a subtle embroidered chest logo and a bold "Rastah Made in Pakistan" graphic across the back, this oversized tee celebrates local craftsmanship while delivering effortless everyday comfort. Features Premium cotton construction Unique acid-wash finish for a vintage look Relaxed oversized fit Soft and breathable fabric Signature embroidered chest logo Large "Made in Pakistan" graphic print on the back Ribbed crew neckline for durability and comfort Dropped shoulders for a modern streetwear silhouette Azure grey colorway with washed effect Designed for everyday wear and versatile styling Care Guide Machine wash cold with similar colors Wash inside out to preserve the graphic and wash effect Do not bleach Do not soak Tumble dry low or hang dry Cool iron on reverse side if needed Do not iron directly on printed artwork Due to the garment wash process, slight color variations are natural Store in a cool, dry place

  • Premium cotton construction
  • Unique acid-wash finish for a vintage look
  • Relaxed oversized fit
  • Soft and breathable fabric
  • Signature embroidered chest logo
  • Large "Made in Pakistan" graphic print on the back
  • Ribbed crew neckline for durability and comfort
  • Dropped shoulders for a modern streetwear silhouette
  • Azure grey colorway with washed effect
  • Designed for everyday wear and versatile styling
  • Machine wash cold with similar colors
  • Wash inside out to preserve the graphic and wash effect
Product type
T-Shirt
Vendor
CORE V6
SKU AZUREACIDWASHMADEINPAKT-SHIRT(V6)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 101

In stock · ready to checkout

View in 3DBuy nowFull listing
Baby blue logo T-shirt

T-Shirt

Baby blue logo T-shirt

An essentials rastah piece in a baby blue garment dyed color featuring the exclusive INTERMISSION IV logo that will NOT be released again in the future.

An essentials rastah piece in a baby blue garment dyed color featuring the exclusive INTERMISSION IV logo that will NOT be released again in the future. The garment is constructed from long staple cotton for extra softness and comfort. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah INTERMISSION IV monogram embroidered on front hand screen printed artwork on the back Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah INTERMISSION IV monogram embroidered on front
  • hand screen printed artwork on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
INTERMISSION 4
Compare at
PKR 79
SKU BABYBLUELOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Baby green logo T-shirt

T-Shirt

Baby green logo T-shirt

An essentials rastah piece in a baby green garment dyed color featuring the exclusive INTERMISSION IV logo that will NOT be released again in the future.

An essentials rastah piece in a baby green garment dyed color featuring the exclusive INTERMISSION IV logo that will NOT be released again in the future. The garment is constructed from long staple cotton for extra softness and comfort. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah INTERMISSION IV monogram embroidered on front hand screen printed artwork on the back Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah INTERMISSION IV monogram embroidered on front
  • hand screen printed artwork on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
INTERMISSION 4
SKU BABYGREENLOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Bachpan Blues T-Shirt

T-Shirt

Bachpan Blues T-Shirt

Childhood looked like washed-out blues — the color of school uniforms, faded jeans, the sky right before the monsoon broke.

Childhood looked like washed-out blues — the color of school uniforms, faded jeans, the sky right before the monsoon broke. This piece holds that washed-out feeling: acid-washed jersey, a screen-printed graphic on the back, English Rastah logo at the front, and hand-set stones and beads detailing that catch light the way memory does — unexpectedly, all at once. Part of the Threads of Nostalgia capsule is a collection rooted in late-20th- and early-21st-century Pakistani memory. Cassette tapes, slow Sunday mornings, nani's almari, gol gappay walay ki cycle. This drop translates those moments into hand-finished streetwear, designed to live with you, not just be owned. Key Features Premium 180 GSM cotton jersey base Acid wash finish for a vintage, lived-in look Screen-printed graphic on the back Screen-printed English Rastah logo at the front Hand-set stones and beads embellishment Oversized relaxed fit Hand-finished garment — minor irregularities are part of the craft Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium 180 GSM cotton jersey base
  • Acid wash finish for a vintage, lived-in look
  • Screen-printed graphic on the back
  • Screen-printed English Rastah logo at the front
  • Hand-set stones and beads embellishment
  • Oversized relaxed fit
  • Hand-finished garment — minor irregularities are part of the craft
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect the patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
Threads of Nostalgia
SKU BACHPANBLUEST-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 106

Currently unavailable

View in 3DFull listing
Bachpan T-shirt

T-Shirt

Bachpan T-shirt

A nostalgic ode to childhood, this yellow terry t-shirt features a playful hand-drawn screen print that evokes the simplicity of home, nature, and imagination.

A nostalgic ode to childhood, this yellow terry t-shirt features a playful hand-drawn screen print that evokes the simplicity of home, nature, and imagination. The relaxed silhouette and soft finish make it perfect for everyday ease with storytelling charm. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: 100% cotton terry fabric Hand-drawn screen print artwork Relaxed, oversized fit Washed yellow tone for a lived-in feel Urdu text accent for cultural resonance Care Instructions: Dry clean only

  • 100% cotton terry fabric
  • Hand-drawn screen print artwork
  • Relaxed, oversized fit
  • Washed yellow tone for a lived-in feel
  • Urdu text accent for cultural resonance
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU BACHPANT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
Bachpan Wala Itwar T-Shirt

T-Shirt

Bachpan Wala Itwar T-Shirt

Sunday mornings hit different.

Sunday mornings hit different. The smell of halwa puri drifting in from the street, ammi's voice from the kitchen, an old film playing on PTV. That slow, terracotta-warm feeling of doing nothing in particular — woven into a single tee. Acid-washed jersey, screen-printed artwork at the back, screen-printed Rastah logo at the front, and woolen fashion stitches that give the piece its hand-finished texture. Part of the Threads of Nostalgia capsule is a collection rooted in late-20th- and early-21st-century Pakistani memory. Cassette tapes, slow Sunday mornings, nani's almari, gol gappay walay ki cycle. This drop translates those moments into hand-finished streetwear, designed to live with you, not just be owned. Key Features Premium 180 GSM cotton jersey base Acid wash finish for a vintage, lived-in look Screen-printed Rastah logo at the front Screen-printed artwork on the back Woolen fashion stitches at the front Oversized relaxed fit Hand-finished garment — minor irregularities are part of the craft Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium 180 GSM cotton jersey base
  • Acid wash finish for a vintage, lived-in look
  • Screen-printed Rastah logo at the front
  • Screen-printed artwork on the back
  • Woolen fashion stitches at the front
  • Oversized relaxed fit
  • Hand-finished garment — minor irregularities are part of the craft
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect the patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
Threads of Nostalgia
SKU BACHPANWALAITWART-SHIRT-S-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 106

In stock · ready to checkout

View in 3DBuy nowFull listing
Backstory T-Shirt

T-Shirt

Backstory T-Shirt

Every piece has a story.

Every piece has a story. This one wears it on the back a screen-printed artwork that tells the wearer's history in ink, while the front carries hand-woven fabric patches and an embroidered Rastah logo. The hero piece of the Yaadgar capsule, built for those who don't explain themselves, lets the garment speak. Part of the Threads of Nostalgia capsule is a collection rooted in late-20th- and early-21st-century Pakistani memory. Cassette tapes, slow Sunday mornings, nani's almari, gol gappay walay ki cycle. This drop translates those moments into hand-finished streetwear, designed to live with you, not just be owned. Key Features Premium 180 GSM cotton jersey base Screen-printed signature artwork on the back Hand-woven fabric patchwork at the front Hand-embroidered Rastah logo Oversized relaxed fit Hand-finished hero piece, minor irregularities are part of the craft Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium 180 GSM cotton jersey base
  • Screen-printed signature artwork on the back
  • Hand-woven fabric patchwork at the front
  • Hand-embroidered Rastah logo
  • Oversized relaxed fit
  • Hand-finished hero piece, minor irregularities are part of the craft
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect the patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
Threads of Nostalgia
SKU BACKSTORYT-SHIRT-XS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 88

In stock · ready to checkout

View in 3DBuy nowFull listing
Bagh-E-Nazar block print T-shirt

T-Shirt

Bagh-E-Nazar block print T-shirt

A reverent nod to South Asian textile heritage, the Bagh-e-Nazar Tee merges handcrafted artistry with a modern streetwear silhouette.

A reverent nod to South Asian textile heritage, the Bagh-e-Nazar Tee merges handcrafted artistry with a modern streetwear silhouette. Made from soft and breathable dobby-woven cotton , the tee features vertical maroon jacquard-style stripes that guide the eye downward—framing the block-printed floral motifs along the hem in striking green and maroon. Finished with a contrast maroon ribbed neckline , and a hand-embroidered Rastah logo patch on the chest, this piece is both an ode to tradition and a bold statement of contemporary identity. Key Features Fabric : 100% dobby cotton with light texture and breathable feel Print : Traditional South Asian block print floral border in green and maroon Trim : Ribbed contrast neckline in deep maroon Logo : Embroidered Rastah logo patch on chest Fit : Relaxed and boxy Care Instructions Dry clean only

  • Fabric : 100% dobby cotton with light texture and breathable feel
  • Print : Traditional South Asian block print floral border in green and maroon
  • Trim : Ribbed contrast neckline in deep maroon
  • Logo : Embroidered Rastah logo patch on chest
  • Fit : Relaxed and boxy
  • Dry clean only
Product type
T-Shirt
Vendor
EMERALD DREAMS
SKU RASTAH-10009263472952

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 220

Currently unavailable

View in 3DFull listing
Basic rust orange logo T-shirt

T-Shirt

Basic rust orange logo T-shirt

Lightweight and oversized t shirt in a beautiful rust orange color with Rastah's Volume VI monogram printed on the front.

Lightweight and oversized t shirt in a beautiful rust orange color with Rastah's Volume VI monogram printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah Volume VI monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'11 and 150 lbs wearing: Medium | Female Model: 5'10 and 105 lbs wearing small *This is a limited edition item. No restocks*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah Volume VI monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'11 and 150 lbs wearing: Medium | Female Model: 5'10 and 105 lbs wearing small
Product type
T-Shirt
Vendor
VOLUME VI
SKU BASICRUSTORANGELOGOTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 49

Currently unavailable

View in 3DFull listing
Bazm Patchwork T-Shirt

T-Shirt

Bazm Patchwork T-Shirt

Bazm — the gathering.

Bazm — the gathering. A bazm is not a crowd; it is a specific kind of assembly, the kind that forms around music, poetry, or conversation worth having. The Bazm Patchwork T-Shirt is designed for that environment: layered, expressive, built for a room full of people who notice things. On a black jersey base, block-printed khaddar patches are arranged across the shirt body and joined using a zigzag stitch — a technique borrowed from ralli patchwork tradition, where the stitch itself is part of the visible design. A direct block print runs on the body beneath and around the patches, creating a ground pattern that the patches interrupt and extend. The chest carries a screen-printed RASTAH logo, clean against the layered surface. The zigzag stitch is structural and decorative simultaneously — it holds the patches in place while creating a visible rhythm across the garment. Black jersey provides the foundation that makes both the block print and the khaddar patches legible. The combination of direct printing on the base fabric and applied printed patches produces a reading experience: you see the shirt differently depending on which element your eye finds first. A bazm only works when everyone brings something. This shirt brings three things at once: the block print, the patches, and the stitch that holds them together. Key Features Black jersey construction Block-printed khaddar patches applied in zigzag stitch arrangement Direct block print on garment body Screen-printed RASTAH logo at chest Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Black jersey construction
  • Block-printed khaddar patches applied in zigzag stitch arrangement
  • Direct block print on garment body
  • Screen-printed RASTAH logo at chest
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
SKU BAZMPATCHWORKT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 145

Currently unavailable

View in 3DFull listing
Beige acid wash T-shirt

T-Shirt

Beige acid wash T-shirt

This lightweight jersey t-shirt features acid wash finishing , creating a textured vintage look.

This lightweight jersey t-shirt features acid wash finishing , creating a textured vintage look. Intricate seam paneling runs along the front and back, elevating the silhouette beyond a classic tee. The centerpiece is bold hand screen-printed Urdu typography with “Made in Pakistan” script, celebrating heritage with a contemporary graphic edge. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. 🔹 Key Features Lightweight jersey cotton Acid wash treatment for a unique vintage texture Intricate panel seam detailing Hand screen-printed Urdu typography (front & back) Relaxed fit with raw edge aesthetics Cultural heritage fused with modern streetwear 🔹 Care Instructions Hand wash or machine wash on cold cycle with mild detergent. Wash inside out to protect prints and colours. Do not bleach. Dry on low heat cycle or lay flat in shade.

  • Lightweight jersey cotton
  • Acid wash treatment for a unique vintage texture
  • Intricate panel seam detailing
  • Hand screen-printed Urdu typography (front & back)
  • Relaxed fit with raw edge aesthetics
  • Cultural heritage fused with modern streetwear
  • Hand wash or machine wash on cold cycle with mild detergent.
  • Wash inside out to protect prints and colours.
  • Do not bleach.
  • Dry on low heat cycle or lay flat in shade.
Product type
T-Shirt
Vendor
CORE F/W-25
SKU BEIGEACIDWASHT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 88

In stock · ready to checkout

View in 3DBuy nowFull listing
Beige block print kalamkaar T-shirt

T-Shirt

Beige block print kalamkaar T-shirt

A handcrafted cotton t-shirt featuring traditional block-printed panels and paisley motifs.

A handcrafted cotton t-shirt featuring traditional block-printed panels and paisley motifs. The front showcases a hand-drawn elephant artwork and screen-printed logo, blending South Asian craft heritage with contemporary streetwear form. Key Features 100% cotton fabric Hand block-printed panels Paisley and floral motifs Screen-printed elephant artwork Screen-printed logo on front Care Instructions Hand wash or machine wash on cold cycle with mild detergent. Wash inside out to protect prints and colours. Do not bleach. Dry on low heat cycle or lay flat in shade.

  • 100% cotton fabric
  • Hand block-printed panels
  • Paisley and floral motifs
  • Screen-printed elephant artwork
  • Screen-printed logo on front
  • Hand wash or machine wash on cold cycle with mild detergent.
  • Wash inside out to protect prints and colours.
  • Do not bleach.
  • Dry on low heat cycle or lay flat in shade.
Product type
T-Shirt
Vendor
A Summer in Firenze
SKU BEIGEBLOCKPRINTKALAMKAARTSHIRT-M-01

Sizes / variants: M

LAIZ escrow price

PKR 141

Currently unavailable

View in 3DFull listing
Beige block printed T-shirt

T-Shirt

Beige block printed T-shirt

This beige block printed shirt was constructed entirely in lightweight fleece.

This beige block printed shirt was constructed entirely in lightweight fleece. The shirt has been block printed at the back with minimal motifs and a logo at the front. slightly oversized fit 200 gsm heavyweight fleece in a cotton and polyester mix Rastah logo printed on the front hand block printed elements on the back and sleeves Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small *THIS COLLECTION WILL BE AVAILABLE ON THE 21st FOR SALE AND WILL BE SHIPPED ON THE 23rd*

  • slightly oversized fit
  • 200 gsm heavyweight fleece in a cotton and polyester mix
  • Rastah logo printed on the front
  • hand block printed elements on the back and sleeves
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
INTERMISSION VI
Compare at
PKR 86
SKU BEIGEBLOCKPRINTEDT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 86

Currently unavailable

View in 3DFull listing
Beige cascade logo T-shirt

T-Shirt

Beige cascade logo T-shirt

The Rastah Cascade T-Shirt transforms typography into movement.

The Rastah Cascade T-Shirt transforms typography into movement. Set on a deep beige base, layered Urdu text flows vertically across the front — creating a cascading visual rhythm that feels both graphic and poetic. The bold Rastah logo anchors the composition, while repeated script detailing builds intensity through repetition. Designed for everyday wear, the relaxed silhouette balances strong visual identity with clean structure. Crafted from premium cotton, the piece offers breathable comfort while maintaining shape, making it an easy statement essential. Key Features Premium cotton construction Relaxed fit silhouette Large front screen-printed graphic Layered Urdu typography design Signature Rastah logo detail Soft yet structured feel Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium cotton construction
  • Relaxed fit silhouette
  • Large front screen-printed graphic
  • Layered Urdu typography design
  • Signature Rastah logo detail
  • Soft yet structured feel
Product type
T-Shirt
Vendor
SS’26
SKU BEIGECASCADELOGOT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 66

Currently unavailable

View in 3DFull listing
Beige contrast T-shirt (V5)

T-Shirt

Beige contrast T-shirt (V5)

A breathable 100% cotton beige jersey t-shirt featuring black contrast piping and neckline.

A breathable 100% cotton beige jersey t-shirt featuring black contrast piping and neckline. Oversized fit with a screen-printed Urdu "Rastah" logo on the chest—minimal, modern, and rooted in cultural identity. Key Features: Color: Beige with black contrast Material: 100% cotton jersey Fit: Oversized Design: Screen-printed Urdu logo on front Details: Ribbed neck and sleeve piping Care Instructions: Machine wash cold Do not bleach Tumble dry low or hang dry Iron inside out on low heat

  • Color: Beige with black contrast
  • Material: 100% cotton jersey
  • Fit: Oversized
  • Design: Screen-printed Urdu logo on front
  • Details: Ribbed neck and sleeve piping
  • Machine wash cold
  • Do not bleach
  • Tumble dry low or hang dry
  • Iron inside out on low heat
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BEIGECONTRASTT-SHIRT(V5)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Beige jersey raglan T-shirt

T-Shirt

Beige jersey raglan T-shirt

A clean and classic silhouette crafted for everyday wear.

A clean and classic silhouette crafted for everyday wear. This beige jersey t-shirt features a minimal screen-printed Urdu logo on the chest, celebrating cultural identity with simplicity. Tailored for a regular fit, it offers a soft and breathable feel perfect for daily layering or standalone styling. Key Features: Color: Beige Material: Jersey Fit: Regular fit Design: Minimal screen-printed Urdu logo on front Finish: Clean neckline and hem for versatile wear Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed (avoid ironing directly on print)

  • Color: Beige
  • Material: Jersey
  • Fit: Regular fit
  • Design: Minimal screen-printed Urdu logo on front
  • Finish: Clean neckline and hem for versatile wear
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed (avoid ironing directly on print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BEIGEJERSEYRAGLANTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 62

Currently unavailable

View in 3DFull listing
Beige knit cotton jersey T-shirt

T-Shirt

Beige knit cotton jersey T-shirt

A versatile everyday essential redefined — this black knit cotton jersey tee features contrast ribbed neckline and sleeve edges, accented with cream piping along raglan seams and a screen-printed Urdu logo at chest.

A versatile everyday essential redefined — this black knit cotton jersey tee features contrast ribbed neckline and sleeve edges, accented with cream piping along raglan seams and a screen-printed Urdu logo at chest. Soft, structured, and elevated with a minimal graphic edge. Key Features: Fabric: Knit cotton jersey Color: Beige with black contrast trim Screen-printed Urdu logo on chest Contrast neckline, sleeve hem & shoulder piping Regular fit with raglan sleeves Care Instructions: Machine wash cold with like colors Turn inside out before washing Tumble dry low or air dry

  • Fabric: Knit cotton jersey
  • Color: Beige with black contrast trim
  • Screen-printed Urdu logo on chest
  • Contrast neckline, sleeve hem & shoulder piping
  • Regular fit with raglan sleeves
  • Machine wash cold with like colors
  • Turn inside out before washing
  • Tumble dry low or air dry
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BEIGEKNITCOTTONJERSEYTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 62

Currently unavailable

View in 3DFull listing
Beige lightweight made in PAK T-shirt (V5)

T-Shirt

Beige lightweight made in PAK T-shirt (V5)

An oversized t-shirt crafted from 100% cotton jersey fabric in a clean cream tone.

An oversized t-shirt crafted from 100% cotton jersey fabric in a clean cream tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton jersey Color: Cream Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton jersey
  • Color: Cream
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
Compare at
PKR 93
SKU BEIGELIGHTWEIGHTMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 60

Currently unavailable

View in 3DFull listing
Beige logo T-shirt (V1)

T-Shirt

Beige logo T-shirt (V1)

The Beige Rastah Logo T-Shirt showcases simplicity, featuring the Rastah logo puff printed in Urdu on the front.

The Beige Rastah Logo T-Shirt showcases simplicity, featuring the Rastah logo puff printed in Urdu on the front. Crafted from 220 GSM cotton terry fabric, this garment-dyed t-shirt is cut in an oversized fit, offering a casual and comfortable look. The fabrication for this piece is a custom blend specifically created for rastah. Key Features: Urdu Rastah logo on the front 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BEIGELOGOTSHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
Beige made in PAK T-shirt (V1)

T-Shirt

Beige made in PAK T-shirt (V1)

The Beige Rastah Logo T-Shirt subtly exhibits the Rastah brand, featuring an English Rastah logo on the front and "Made in Pakistan" on the back.

The Beige Rastah Logo T-Shirt subtly exhibits the Rastah brand, featuring an English Rastah logo on the front and "Made in Pakistan" on the back. Made from 220 GSM cotton terry fabric, this t-shirt is designed with an oversized fit for a comfortable, laid-back style. The fabrication is made entirely custom to Rastah's specifications for a truly unique feel. Key Features: English Rastah logo on the front "Made in Pakistan" on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • English Rastah logo on the front
  • "Made in Pakistan" on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BEIGEMADEINPAKTSHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Beige made in PAK T-shirt (V2)

T-Shirt

Beige made in PAK T-shirt (V2)

Crafted with meticulous detail, this Beige T-Shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back.

Crafted with meticulous detail, this Beige T-Shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back. Constructed from 220 GSM cotton jersey fabric, this shirt boasts an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front "Made in Pakistan" in Urdu typography on the back 220 GSM 100% cotton jersey fabric Garment dyed Oversized fit Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • "Made in Pakistan" in Urdu typography on the back
  • 220 GSM 100% cotton jersey fabric
  • Garment dyed
  • Oversized fit
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
RESTOCK
Compare at
PKR 79
SKU BEIGEMADEINPAKT-SHIRT(V2)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 72

In stock · ready to checkout

View in 3DBuy nowFull listing
Beige made in PAK T-shirt (V3)

T-Shirt

Beige made in PAK T-shirt (V3)

Crafted with meticulous detail, this Beige T-Shirt subtly features the Rastah emblem on the front, while the back displays the bold English Rastah logo, flanked

Crafted with meticulous detail, this Beige T-Shirt subtly features the Rastah emblem on the front, while the back displays the bold English Rastah logo, flanked by the Urdu Rastah logo and Urdu typography reading "Made in Pakistan". Constructed from 220 GSM cotton terry fabric, this shirt boasts an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front English Rastah logo, flanked by the Urdu Rastah logo and Urdu typography reading "Made in Pakistan" on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas

  • Urdu Rastah logo on the front
  • English Rastah logo, flanked by the Urdu Rastah logo and Urdu typography reading "Made in Pakistan" on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BEIGEMADEINPAKTSHIRT(V3)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Beige made in PAK T-shirt (V4)

T-Shirt

Beige made in PAK T-shirt (V4)

Elevate your wardrobe with the Beige Made in Pak T-Shirt – Version 4 .

Elevate your wardrobe with the Beige Made in Pak T-Shirt – Version 4 . Designed in a timeless porcelain shade, this oversized t-shirt blends minimalist aesthetics with cultural pride, making it a versatile and essential piece for any occasion. Crafted from premium 220 GSM cotton, it offers lightweight comfort and long-lasting quality. The front features a sleek screen-printed Urdu "Rastah" logo for understated elegance, while the back makes a bold statement with: A clean puff-printed English "Rastah" logo in black. Urdu text reading: "Designed in Rastah Studio Lahore, Made in Pakistan." A crescent moon and star symbol alongside "Established in 2018" , reflecting heritage and craftsmanship. Key Features: Material : 100% premium cotton fabric (220 GSM) for lightweight breathability. Front : Screen-printed Urdu "Rastah" logo for a refined look. Back : Puff-printed English "Rastah" logo with Urdu typography and cultural details. Fit : Oversized design for a modern, relaxed silhouette. Care Instructions: Machine wash cold with like colors. Tumble dry low or hang to dry. Iron on low, avoiding printed areas.

  • A clean puff-printed English "Rastah" logo in black.
  • Urdu text reading: "Designed in Rastah Studio Lahore, Made in Pakistan."
  • A crescent moon and star symbol alongside "Established in 2018" , reflecting heritage and craftsmanship.
  • Material : 100% premium cotton fabric (220 GSM) for lightweight breathability.
  • Front : Screen-printed Urdu "Rastah" logo for a refined look.
  • Back : Puff-printed English "Rastah" logo with Urdu typography and cultural details.
  • Fit : Oversized design for a modern, relaxed silhouette.
  • Machine wash cold with like colors.
  • Tumble dry low or hang to dry.
  • Iron on low, avoiding printed areas.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU PORCELAINMADEINPAKT-SHIRT(V4)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Beige made in PAK T-shirt (V5)

T-Shirt

Beige made in PAK T-shirt (V5)

An oversized t-shirt crafted from 100% cotton terry fabric in a clean cream tone.

An oversized t-shirt crafted from 100% cotton terry fabric in a clean cream tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton terry Color: Cream Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton terry
  • Color: Cream
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BEIGEMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 93

In stock · ready to checkout

View in 3DBuy nowFull listing
Bethak T-Shirt

T-Shirt

Bethak T-Shirt

Bethak means sitting room — the space in a South Asian home reserved for gathering, for guests, for the conversations that happen after dinner when no one wants to leave.

Bethak means sitting room — the space in a South Asian home reserved for gathering, for guests, for the conversations that happen after dinner when no one wants to leave. It is a room of presence, not transit. The Bethak T-Shirt is dressed for that room: bold enough to be seen, layered enough to hold attention for the whole evening. On a cherry jersey base, the shirt is built around an exceptional density of craft. A multi-head machine-embroidered border runs across the back, a garment-spanning detail that makes the back as strong as the front. The front carries a screen-printed RASTAH logo and back artwork, while jute sublimation patches add a rougher material layer. A multi-head embroidered detail on the front completes the composition. Cherry is a colour that announces itself. It doesn't blend into backgrounds or ask for permission. Against it, the embroidered border reads like architectural detail — a frame around a wall, an archway over a doorway. The jute patches introduce a material modesty that keeps the shirt from becoming purely decorative. The bethak is where RASTAH's cultural reference lives most comfortably: a gathering space, a room with history, a place where craft and conversation exist together. This shirt was made for that room. Key Features Cherry jersey construction Multi-head machine-embroidered back border Screen-printed back artwork and front RASTAH logo Jute sublimation patches Multi-head embroidered front detail Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Cherry jersey construction
  • Multi-head machine-embroidered back border
  • Screen-printed back artwork and front RASTAH logo
  • Jute sublimation patches
  • Multi-head embroidered front detail
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
SKU BETHAKT-SHIRT-M-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 115

In stock · ready to checkout

View in 3DBuy nowFull listing
Black acid wash graffiti T-shirt

T-Shirt

Black acid wash graffiti T-shirt

Crafted from 100% cotton fleece with a soft acid wash finish, it carries a textured, vintage feel.

Crafted from 100% cotton fleece with a soft acid wash finish, it carries a textured, vintage feel. A bold, screen-printed Rastah Black Acid Wash graphic adorns the back, while the front features the iconic Urdu logo — combining raw modernity with deep-rooted cultural identity. Key Features: 100% cotton fleece Acid wash treatment for a lived-in texture Screen-printed Rastah Black Acid Wash back graphic Urdu logo on front chest Relaxed fit with dropped shoulders Care Instructions: Hand wash or gentle cold-cycle machine wash with mild detergent. Wash inside out to protect print and color. Do not bleach. Lay flat or hang to dry in the shade.

  • 100% cotton fleece
  • Acid wash treatment for a lived-in texture
  • Screen-printed Rastah Black Acid Wash back graphic
  • Urdu logo on front chest
  • Relaxed fit with dropped shoulders
Product type
T-Shirt
Vendor
BFCM 2025
SKU BLACKACIDWASHGRAFFITIT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Black acid wash made in PAK T-shirt (V4)

T-Shirt

Black acid wash made in PAK T-shirt (V4)

Introduce boldness to your wardrobe with the Black Acid Wash Made in Pak T-Shirt – Version 4 , a fusion of edgy streetwear and cultural craftsmanship.

Introduce boldness to your wardrobe with the Black Acid Wash Made in Pak T-Shirt – Version 4 , a fusion of edgy streetwear and cultural craftsmanship. The black acid-wash finish delivers a unique vintage aesthetic, while its oversized fit and premium fabric offer a contemporary and comfortable look. Crafted from 220 GSM cotton , this piece is lightweight yet durable, perfect for year-round wear. Front Design : Features a screen-printed Urdu "Rastah" logo , adding a refined and subtle detail. Back Design : A striking display with: A puff-printed English "Rastah" logo in cream. Urdu typography reading: "Designed in Rastah Studio Lahore, Made in Pakistan." A crescent moon and star emblem alongside "Established in 2018" , reflecting cultural heritage and pride. The t-shirt’s oversized silhouette makes it a versatile staple, ideal for layering or as a statement standalone piece. Key Features: Material : Crafted from 100% premium 220 GSM cotton for breathable, lightweight comfort. Front : Screen-printed Urdu "Rastah" logo for understated elegance. Back : Puff-printed English "Rastah" logo, complemented by intricate Urdu text and cultural elements. Finish : Black acid wash for a unique, vintage aesthetic. Fit : Oversized design for a modern, relaxed silhouette. Care Instructions: Machine wash cold with similar colors. Use mild detergent; avoid bleach. Tumble dry low or hang to dry. Iron on low heat, avoiding printed areas.

  • Front Design : Features a screen-printed Urdu "Rastah" logo , adding a refined and subtle detail.
  • Back Design : A striking display with: A puff-printed English "Rastah" logo in cream.
  • Urdu typography reading: "Designed in Rastah Studio Lahore, Made in Pakistan."
  • A crescent moon and star emblem alongside "Established in 2018" , reflecting cultural heritage and pride.
  • Material : Crafted from 100% premium 220 GSM cotton for breathable, lightweight comfort.
  • Front : Screen-printed Urdu "Rastah" logo for understated elegance.
  • Back : Puff-printed English "Rastah" logo, complemented by intricate Urdu text and cultural elements.
  • Finish : Black acid wash for a unique, vintage aesthetic.
  • Fit : Oversized design for a modern, relaxed silhouette.
  • Machine wash cold with similar colors.
  • Use mild detergent; avoid bleach.
  • Tumble dry low or hang to dry.
Product type
T-Shirt
Vendor
RESTOCK
SKU BLACKACIDWASHMADEINPAKT-SHIRT(V4)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 84

In stock · ready to checkout

View in 3DBuy nowFull listing
Black acid wash made in PAK T-shirt (V5)

T-Shirt

Black acid wash made in PAK T-shirt (V5)

An oversized t-shirt crafted from 100% cotton jersey fabric in an acid wash black tone .

An oversized t-shirt crafted from 100% cotton jersey fabric in an acid wash black tone . Soft, breathable, and lightweight, it features a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, blending cultural expression with effortless streetwear energy. Key Features: Fabric: 100% cotton jersey 200 GSM 100% cotton jersey fabric Color: Acid Wash Black Fit: Oversized Front: Minimal screen-printed Urdu logo Back: Large “To Rastah” screen print in English and Urdu Finish: Dropped shoulders with a relaxed, easy drape for everyday comfort Care Instructions: Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade Iron inside out on low (avoid print)

  • 200 GSM 100% cotton jersey fabric
Product type
T-Shirt
Vendor
RESTOCK
Compare at
PKR 84
SKU BLACKACIDWASHMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 76

In stock · ready to checkout

View in 3DBuy nowFull listing
Black Acid Wash made in Pak T-shirt (V6)

T-Shirt

Black Acid Wash made in Pak T-shirt (V6)

Crafted from soft jersey fabric, the MIP Tee combines everyday comfort with bold visual expression.

Crafted from soft jersey fabric, the MIP Tee combines everyday comfort with bold visual expression. A statement screen-printed graphic on the back adds character, while the clean silhouette and versatile washed black tone make it an easy wardrobe staple. Features Soft jersey construction Screen-printed back design Classic crew neckline Relaxed fit Everyday essential Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Do not iron directly on print Wash with similar colors

  • Soft jersey construction
  • Screen-printed back design
  • Classic crew neckline
  • Relaxed fit
  • Everyday essential
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Do not iron directly on print
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU BLACKACIDWASHMADEINPAKT-SHIRTV6-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 101

In stock · ready to checkout

View in 3DBuy nowFull listing
Black acid wash patchwork T-shirt

T-Shirt

Black acid wash patchwork T-shirt

This t-shirt combines raw texture with handcrafted storytelling.

This t-shirt combines raw texture with handcrafted storytelling. Made from soft acid-washed cotton, it features hand-cut khaddar fabric patches that are block-printed with traditional motifs and stitched onto the base using colorful hand-sewn embroidery. Each patch tells a fragment of artistic history, paying tribute to the region's textile artisans. The screen-printed logo patch anchors the design in modern heritage. Key Features: 220 GSM 100% cotton terry Khaddar block-printed fabric patches Hand-stitched borders in contrasting thread Screen-printed signature patch Relaxed fit Each piece is unique due to handcrafted elements Care Instructions: Dry Clean Only

  • 220 GSM 100% cotton terry
  • Khaddar block-printed fabric patches
  • Hand-stitched borders in contrasting thread
  • Screen-printed signature patch
  • Relaxed fit
  • Each piece is unique due to handcrafted elements
  • Dry Clean Only
Product type
T-Shirt
Vendor
UNLUCKY CHARMS
Compare at
PKR 119
SKU BLACKACIDWASHPATCHWORKTSHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 66

Currently unavailable

View in 3DFull listing
Black cascade logo T-shirt

T-Shirt

Black cascade logo T-shirt

The Rastah Cascade T-Shirt transforms typography into movement.

The Rastah Cascade T-Shirt transforms typography into movement. Set on a deep black base, layered Urdu text flows vertically across the front — creating a cascading visual rhythm that feels both graphic and poetic. The bold Rastah logo anchors the composition, while repeated script detailing builds intensity through repetition. Designed for everyday wear, the relaxed silhouette balances strong visual identity with clean structure. Crafted from premium cotton, the piece offers breathable comfort while maintaining shape, making it an easy statement essential. Key Features Premium cotton construction Relaxed fit silhouette Large front screen-printed graphic Layered Urdu typography design Signature Rastah logo detail Soft yet structured feel Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium cotton construction
  • Relaxed fit silhouette
  • Large front screen-printed graphic
  • Layered Urdu typography design
  • Signature Rastah logo detail
  • Soft yet structured feel
Product type
T-Shirt
Vendor
SS’26
SKU BLACKCASCADELOGOT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 66

Currently unavailable

View in 3DFull listing
Black contrast T-shirt (V5)

T-Shirt

Black contrast T-shirt (V5)

A breathable 100% cotton black jersey t-shirt featuring beige contrast piping and neckline.

A breathable 100% cotton black jersey t-shirt featuring beige contrast piping and neckline. Oversized fit with a screen-printed Urdu "Rastah" logo on the chest—minimal, modern, and rooted in cultural identity. Key Features: Color: Black with beige contrast Material: 100% cotton jersey Fit: Oversized Design: Screen-printed Urdu logo on front Details: Ribbed neck and sleeve piping Care Instructions: Machine wash cold Do not bleach Tumble dry low or hang dry Iron inside out on low heat

  • Color: Black with beige contrast
  • Material: 100% cotton jersey
  • Fit: Oversized
  • Design: Screen-printed Urdu logo on front
  • Details: Ribbed neck and sleeve piping
  • Machine wash cold
  • Do not bleach
  • Tumble dry low or hang dry
  • Iron inside out on low heat
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLACKCONTRASTT-SHIRT(V5)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Black graffiti T-shirt

T-Shirt

Black graffiti T-shirt

Crafted from 100% cotton jersey, it features a vibrant screen-printed Urdu logo on the front and a large Rastah “Made in Pakistan” print on the back.

Crafted from 100% cotton jersey, it features a vibrant screen-printed Urdu logo on the front and a large Rastah “Made in Pakistan” print on the back. The relaxed silhouette and mid-weight texture make it ideal for year-round wear. Key Features: 100% cotton jersey Screen-printed Rastah logo on front Large back print with “Made in Pakistan” design Relaxed, boxy fit Soft, breathable hand-feel Care Instructions: Hand wash or machine wash on cold cycle with mild detergent. Wash inside out to protect prints and colours. Do not bleach. Dry on low heat cycle or lay flat in the shade.

  • 100% cotton jersey
  • Screen-printed Rastah logo on front
  • Large back print with “Made in Pakistan” design
  • Relaxed, boxy fit
  • Soft, breathable hand-feel
Product type
T-Shirt
Vendor
BFCM 2025
SKU BLACKGRAFFITIT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
Black jersey raglan T-shirt

T-Shirt

Black jersey raglan T-shirt

A clean and classic silhouette crafted for everyday wear.

A clean and classic silhouette crafted for everyday wear. This black jersey t-shirt features a minimal screen-printed Urdu logo on the chest, celebrating cultural identity with simplicity. Tailored for a regular fit, it offers a soft and breathable feel perfect for daily layering or standalone styling. Key Features: Color: Black Material: Jersey Fit: Regular fit Design: Minimal screen-printed Urdu logo on front Finish: Clean neckline and hem for versatile wear Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed (avoid ironing directly on print)

  • Color: Black
  • Material: Jersey
  • Fit: Regular fit
  • Design: Minimal screen-printed Urdu logo on front
  • Finish: Clean neckline and hem for versatile wear
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed (avoid ironing directly on print)
Product type
T-Shirt
Vendor
CORE COLLECTION
Compare at
PKR 62
SKU BLACKJERSEYRAGLANTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 40

Currently unavailable

View in 3DFull listing
Black knit cotton jersey T-shirt

T-Shirt

Black knit cotton jersey T-shirt

A versatile everyday essential redefined — this black knit cotton jersey tee features contrast ribbed neckline and sleeve edges, accented with cream piping along raglan seams and a screen-printed Urdu logo at chest.

A versatile everyday essential redefined — this black knit cotton jersey tee features contrast ribbed neckline and sleeve edges, accented with cream piping along raglan seams and a screen-printed Urdu logo at chest. Soft, structured, and elevated with a minimal graphic edge. Key Features: Fabric: Knit cotton jersey Color: Black with cream contrast trim Screen-printed Urdu logo on chest Contrast neckline, sleeve hem & shoulder piping Regular fit with raglan sleeves Care Instructions: Machine wash cold with like colors Turn inside out before washing Tumble dry low or air dry Iron inside out on low, avoiding print

  • Fabric: Knit cotton jersey
  • Color: Black with cream contrast trim
  • Screen-printed Urdu logo on chest
  • Contrast neckline, sleeve hem & shoulder piping
  • Regular fit with raglan sleeves
  • Machine wash cold with like colors
  • Turn inside out before washing
  • Tumble dry low or air dry
  • Iron inside out on low, avoiding print
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLACKKNITCOTTONJERSEYTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 62

Currently unavailable

View in 3DFull listing
Black knit jacquard crop top

T-Shirt

Black knit jacquard crop top

A bold blend of craftsmanship and modernity, this black knit jacquard crop top features a pixelated grid pattern throughout.

A bold blend of craftsmanship and modernity, this black knit jacquard crop top features a pixelated grid pattern throughout. With a structured silhouette, half sleeves, and contrast embroidered logo, it’s a contemporary essential rooted in artisanal detail. Key Features: Fabric: Knit jacquard Color: Black with cream pixel pattern Cropped boxy silhouette Half sleeves Screen-printed Urdu logo detail Soft and breathable feel Care Instructions: Hand wash cold Do not bleach Lay flat to dry Iron on low heat inside out Avoid tumble drying

  • Fabric: Knit jacquard
  • Color: Black with cream pixel pattern
  • Cropped boxy silhouette
  • Half sleeves
  • Screen-printed Urdu logo detail
  • Soft and breathable feel
  • Hand wash cold
  • Do not bleach
  • Lay flat to dry
  • Iron on low heat inside out
  • Avoid tumble drying
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLACKKNITJACQUARDCROPTOP-S-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 198

In stock · ready to checkout

View in 3DBuy nowFull listing
Black knitted rib full-sleeve T-shirt

T-Shirt

Black knitted rib full-sleeve T-shirt

A sleek rib-knit shirt crafted from 100% cotton, tailored for a snug, cropped silhouette.

A sleek rib-knit shirt crafted from 100% cotton, tailored for a snug, cropped silhouette. This full-sleeve essential features an embroidered Urdu "Rastah" logo on the chest, blending minimalist design with cultural edge. Key Features: Fabric: 100% cotton rib knit Fit: Slim cropped fit Sleeves: Full length Front: Embroidered Urdu "Rastah" logo Color: Solid black Comfortable stretch texture Care Instructions: Hand or machine wash cold Use mild detergent Do not bleach Lay flat to dry or tumble dry low Iron inside out on low if needed

  • Fabric: 100% cotton rib knit
  • Fit: Slim cropped fit
  • Sleeves: Full length
  • Front: Embroidered Urdu "Rastah" logo
  • Color: Solid black
  • Comfortable stretch texture
  • Hand or machine wash cold
  • Use mild detergent
  • Do not bleach
  • Lay flat to dry or tumble dry low
  • Iron inside out on low if needed
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLACKKNITTEDRIBFULLSLEEVETSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 75

Currently unavailable

View in 3DFull listing
Black lightweight made in PAK T-shirt (V5)

T-Shirt

Black lightweight made in PAK T-shirt (V5)

Product Description: An oversized t-shirt crafted from 100% cotton jersey fabric in a Black tone.

Product Description: An oversized t-shirt crafted from 100% cotton jersey fabric in a Black tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton jersey Color: Black Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton jersey
  • Color: Black
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLACKLIGHTWEIGHTMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Black logo T-shirt (V1)

T-Shirt

Black logo T-shirt (V1)

The Black Rastah Logo T-Shirt subtly exhibits the brand's identity, featuring the Rastah logo puff printed in Urdu on the front.

The Black Rastah Logo T-Shirt subtly exhibits the brand's identity, featuring the Rastah logo puff printed in Urdu on the front. Crafted from 220 GSM cotton terry fabric. The fabric for the piece is custom made for Rastah and its specifications. Key Features: Urdu Rastah logo on the front English Rastah logo and "Made in Pakistan" on the back 220 GSM 100% compact combed cotton Garment dyed Oversized fit Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • English Rastah logo and "Made in Pakistan" on the back
  • 220 GSM 100% compact combed cotton
  • Garment dyed
  • Oversized fit
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
RESTOCK
SKU BLACKLOGOTSHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
Black long sleeve logo shirt

T-Shirt

Black long sleeve logo shirt

Lightweight and oversized long sleeve shirt with Rastah's monogram in white printed on the front.

Lightweight and oversized long sleeve shirt with Rastah's monogram in white printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight pre shrunk terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 16th of August. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight pre shrunk terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
SUMMER ESSENTIALS DROP 02
SKU BLACKLONGSLEEVELOGOSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 75

Currently unavailable

View in 3DFull listing
Black made in PAK full-sleeve shirt (V5)

T-Shirt

Black made in PAK full-sleeve shirt (V5)

Product Description: An oversized sweatshirt crafted from 100% cotton fleece fabric in a Black tone.

Product Description: An oversized sweatshirt crafted from 100% cotton fleece fabric in a Black tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton fleece Color: BLack Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton fleece
  • Color: BLack
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLACKMADEINPAKFULLSLEEVESHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 128

In stock · ready to checkout

View in 3DBuy nowFull listing
Black made in PAK JR T-shirt (V6)

T-Shirt

Black made in PAK JR T-shirt (V6)

The MIP Heritage Graphic Jersey T-Shirt combines premium everyday comfort with bold Pakistani-inspired artwork.

The MIP Heritage Graphic Jersey T-Shirt combines premium everyday comfort with bold Pakistani-inspired artwork. Crafted from soft jersey fabric, it features minimalist Made in Pakistan embroidery on the front and a vibrant screen-printed graphic on the back, celebrating local heritage through contemporary streetwear. Designed with a relaxed fit for effortless all-day wear. Features Premium jersey fabric Soft, breathable, and lightweight Classic crew neckline Relaxed everyday fit Signature MIP (Made in Pakistan) chest embroidery Large heritage-inspired screen print on the back Durable ribbed neckline Comfortable for everyday wear Care Guide Machine wash cold with similar colors Wash inside out to protect the print Do not bleach Tumble dry low or line dry Warm iron inside out if needed Do not iron directly on the print Do not dry clean

  • Premium jersey fabric
  • Soft, breathable, and lightweight
  • Classic crew neckline
  • Relaxed everyday fit
  • Signature MIP (Made in Pakistan) chest embroidery
  • Large heritage-inspired screen print on the back
  • Durable ribbed neckline
  • Comfortable for everyday wear
  • Machine wash cold with similar colors
  • Wash inside out to protect the print
  • Do not bleach
  • Tumble dry low or line dry
Product type
T-Shirt
Vendor
CORE V6
SKU BLACKMADEINPAKJRT-SHIRT(V6)-XL-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 62

In stock · ready to checkout

View in 3DBuy nowFull listing
Black made in PAK T-shirt (V1)

T-Shirt

Black made in PAK T-shirt (V1)

The Black Rastah Logo T-Shirt subtly exhibits the brand's identity, featuring the Rastah logo puff printed in Urdu on the front and the English logo alongside "Made in Pakistan" on the back.

The Black Rastah Logo T-Shirt subtly exhibits the brand's identity, featuring the Rastah logo puff printed in Urdu on the front and the English logo alongside "Made in Pakistan" on the back. Crafted from 220 GSM cotton terry fabric. The fabric for the piece is custom made for Rastah and its specifications. Key Features: Urdu Rastah logo on the front English Rastah logo and "Made in Pakistan" on the back 220 GSM 100% compact combed cotton Garment dyed Oversized fit Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • English Rastah logo and "Made in Pakistan" on the back
  • 220 GSM 100% compact combed cotton
  • Garment dyed
  • Oversized fit
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
RESTOCK
SKU BLACKMADEINPAKTSHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Black made in PAK T-shirt (V2)

T-Shirt

Black made in PAK T-shirt (V2)

Crafted with meticulous detail, this black t-shirt subtly showcases the Rastah emblem on the front , complemented by the “Made in Pakistan” inscription in elegant Urdu typography on the back .

Crafted with meticulous detail, this black t-shirt subtly showcases the Rastah emblem on the front , complemented by the “Made in Pakistan” inscription in elegant Urdu typography on the back . Made from 200 GSM 100% cotton jersey fabric , the shirt offers a soft, breathable feel while maintaining structure and durability. Designed with an oversized fit , it delivers a relaxed yet refined streetwear silhouette. Each garment is garment dyed , reflecting Rastah’s commitment to quality, individuality, and craftsmanship. Key Features: Urdu Rastah logo on the front “Made in Pakistan” in Urdu typography on the back 200 GSM 100% cotton jersey fabric Garment dyed finish for a rich, unique tone Oversized fit for a relaxed, contemporary silhouette Care Instructions: Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect prints Do not bleach Lay flat or hang to dry in the shade Iron inside out on low heat, avoiding printed areas

  • Urdu Rastah logo on the front
  • “Made in Pakistan” in Urdu typography on the back
  • 200 GSM 100% cotton jersey fabric
  • Garment dyed finish for a rich, unique tone
  • Oversized fit for a relaxed, contemporary silhouette
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
  • Iron inside out on low heat, avoiding printed areas
Product type
T-Shirt
Vendor
RESTOCK
Compare at
PKR 79
SKU BLACKMADEINPAKTSHIRT(V2)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 72

In stock · ready to checkout

View in 3DBuy nowFull listing
Black made in PAK T-shirt (V3)

T-Shirt

Black made in PAK T-shirt (V3)

Crafted with meticulous detail, this Black T-Shirt subtly features the Rastah emblem on the front, while the back displays the bold English Rastah logo, flanked

Crafted with meticulous detail, this Black T-Shirt subtly features the Rastah emblem on the front, while the back displays the bold English Rastah logo, flanked by the Urdu Rastah logo and Urdu typography reading "Made in Pakistan". Constructed from 220 GSM cotton terry fabric, this shirt boasts an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front English Rastah logo, flanked by the Urdu Rastah logo and Urdu typography reading "Made in Pakistan" on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas

  • Urdu Rastah logo on the front
  • English Rastah logo, flanked by the Urdu Rastah logo and Urdu typography reading "Made in Pakistan" on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLACKMADEINPAKTSHIRT(V3)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Black made in PAK T-shirt (V4)

T-Shirt

Black made in PAK T-shirt (V4)

Designed in a classic black shade, this essential tee blends timeless style with cultural pride, crafted in soft jersey fabric for everyday comfort.

Designed in a classic black shade, this essential tee blends timeless style with cultural pride, crafted in soft jersey fabric for everyday comfort. Key Features: Material: Made from 200 GSM 100% premium cotton jersey fabric , offering a soft, breathable feel with durability for daily wear. Front Design: Features a sleek screen-printed Urdu "Rastah" logo for a clean and minimalist aesthetic. Back Design: Bold puff-printed English "Rastah" logo in white. Urdu typography reading: "Designed in Rastah Studio Lahore, Made in Pak." Crescent moon and star symbol with "Established in 2018," celebrating craftsmanship and heritage. Fit: Standard fit designed for a comfortable, modern silhouette suitable for everyday wear. Care Instructions: Machine wash cold with similar colors. Tumble dry low or hang dry to maintain shape and fabric quality. Iron on low, avoiding printed areas to prevent fading or cracking.

  • Bold puff-printed English "Rastah" logo in white.
  • Urdu typography reading: "Designed in Rastah Studio Lahore, Made in Pak."
  • Crescent moon and star symbol with "Established in 2018," celebrating craftsmanship and heritage.
Product type
T-Shirt
Vendor
RESTOCK
Compare at
PKR 79
SKU BLACKMADEINPAKT-SHIRT(V4)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 72

In stock · ready to checkout

View in 3DBuy nowFull listing
Black made in PAK T-shirt (V5)

T-Shirt

Black made in PAK T-shirt (V5)

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Black tone.

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Black tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton terry Color: Black Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton terry
  • Color: Black
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLACKMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 79

In stock · ready to checkout

View in 3DBuy nowFull listing
Black made in PAK T-shirt (V6)

T-Shirt

Black made in PAK T-shirt (V6)

Crafted from soft jersey fabric, the MIP Tee is designed for everyday comfort with a minimalist approach.

Crafted from soft jersey fabric, the MIP Tee is designed for everyday comfort with a minimalist approach. A bold back print adds visual impact, while the clean front and relaxed fit maintain a versatile aesthetic. Proudly made in Pakistan. Features Soft jersey construction Statement back print Classic crew neckline Relaxed fit Made in Pakistan Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Do not iron directly on print Wash with similar colors

  • Soft jersey construction
  • Statement back print
  • Classic crew neckline
  • Relaxed fit
  • Made in Pakistan
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Do not iron directly on print
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU BLACKMADEINPAKT-SHIRT(V6)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Black oil wash vintage T-shirt

T-Shirt

Black oil wash vintage T-shirt

For Volume IV, Rastah re-examines its basics and presents elevated garments with greater depth and dimension.

For Volume IV, Rastah re-examines its basics and presents elevated garments with greater depth and dimension. This jet black, Volume IV exclusive crew neck t-shirt was garment dyed and oil washed in-house to give it a unique, distorted vintage feel, with faded seams. The garment is hemmed at the body and sleeves, with a ribbed collar. Rastah Volume IV logo is screen printed on the front panel. *THIS IS A LIMITED EDITION ITEM WHICH WILL NOT BE RESTOCKED ONCE SOLD OUT* Slightly oversized fit Dropped shoulders 270 GSM compact combed terry “Rastah” volume IV monogram printed on front 80/20 Cotton: Polyester ratio Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6ft; Wearing Medium | Female Model: 5'7; Wearing Small

  • Slightly oversized fit
  • Dropped shoulders
  • 270 GSM compact combed terry
  • “Rastah” volume IV monogram printed on front
  • 80/20 Cotton: Polyester ratio
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6ft; Wearing Medium | Female Model: 5'7; Wearing Small
Product type
T-Shirt
Vendor
VOLUME IV
SKU BLACKOILWASHVINTAGET-SHIRT-S-01

Sizes / variants: s · m · l · xl

LAIZ escrow price

PKR 49

Currently unavailable

View in 3DFull listing
Black patchwork T-shirt

T-Shirt

Black patchwork T-shirt

An oversized acid-washed black t-shirt featuring hand-applied patchwork inspired by Henri Matisse’s iconic paper cut-outs.

An oversized acid-washed black t-shirt featuring hand-applied patchwork inspired by Henri Matisse’s iconic paper cut-outs. Each colored patch is cut from denim and frayed around the edges, adding a tactile, deconstructed feel. A screen-printed logo sits on the front — a nod to Rastah’s core visual language. A wearable canvas of form, color, and chaos. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features Oversized silhouette Acid-washed finish Multicolored frayed denim patches (Matisse-inspired) Front screen-printed Rastah logo Dropped shoulders Mid-weight cotton for comfort Care Instructions Dry clean only

  • Oversized silhouette
  • Acid-washed finish
  • Multicolored frayed denim patches (Matisse-inspired)
  • Front screen-printed Rastah logo
  • Dropped shoulders
  • Mid-weight cotton for comfort
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU BLACKPATCHWORKT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
Black postcard T-shirt

T-Shirt

Black postcard T-shirt

A classic screen-printed t-shirt crafted for everyday wear.

A classic screen-printed t-shirt crafted for everyday wear. Made from 100% cotton terry , this piece offers a soft, structured feel with added comfort. It features a clean front with a minimal chest graphic and a bold postcard-inspired artwork at the back. The relaxed silhouette and breathable fabric make it an easy essential — comfortable on its own or layered into your daily rotation. Key Features 100% cotton terry fabric Soft looped interior for added comfort Screen-printed graphics on front and back Breathable yet slightly structured hand feel Relaxed fit for everyday wear Durable print suitable for regular use Crew neckline with reinforced stitching Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton terry fabric
  • Soft looped interior for added comfort
  • Screen-printed graphics on front and back
  • Breathable yet slightly structured hand feel
  • Relaxed fit for everyday wear
  • Durable print suitable for regular use
  • Crew neckline with reinforced stitching
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
SS’26
SKU BLACKPOSTCARDT-SHIRT-XS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 66

In stock · ready to checkout

View in 3DBuy nowFull listing
Black regular fit embroidered logo T-shirt

T-Shirt

Black regular fit embroidered logo T-shirt

This White Jersey regular fit T-Shirt brings a fresh, vibrant look with bold black rib accents on the sleeves and crew neckline.

This White Jersey regular fit T-Shirt brings a fresh, vibrant look with bold black rib accents on the sleeves and crew neckline. The black embroidered Rastah logo on the chest adds a touch of cultural flair. This shirt combines comfort and style, making it a perfect choice for casual and streetwear-inspired looks. Fabric Details Material : Soft and breathable jersey fabric, ensuring all-day comfort. Weight : 220 GSM, providing structure while maintaining a lightweight feel. Design Features Black Ribbed Accents : Contrasting black ribbing on the sleeves and neckline for a pop of color. Embroidered Logo : Signature black Rastah logo on the chest for a distinctive touch. Regular Fit : Comfortable and classic fit designed for everyday wear. Fit Fitting : Regular fit, offering a comfortable and relaxed look. Care Instructions Machine wash in cold water on a gentle cycle. Avoid bleach to preserve fabric and logo quality. Air dry to retain the fabric's softness. Use a cool iron on the reverse side if needed.

  • Material : Soft and breathable jersey fabric, ensuring all-day comfort.
  • Weight : 220 GSM, providing structure while maintaining a lightweight feel.
  • Black Ribbed Accents : Contrasting black ribbing on the sleeves and neckline for a pop of color.
  • Embroidered Logo : Signature black Rastah logo on the chest for a distinctive touch.
  • Regular Fit : Comfortable and classic fit designed for everyday wear.
  • Fitting : Regular fit, offering a comfortable and relaxed look.
  • Machine wash in cold water on a gentle cycle.
  • Avoid bleach to preserve fabric and logo quality.
  • Air dry to retain the fabric's softness.
  • Use a cool iron on the reverse side if needed.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLACKREGULARFITEMBROIDEREDLOGOTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
BLACK T SHIRT FIFA PIPING

T-Shirt

BLACK T SHIRT FIFA PIPING

BLACK T SHIRT FIFA PIPING

BLACK T SHIRT FIFA PIPING from official Rastah storefront.

  • T-Shirt
  • NYC Match Day Pop-Up
Product type
T-Shirt
Vendor
NYC Match Day Pop-Up
SKU BLACKTSHIRTFIFAPIPING-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 158

Currently unavailable

View in 3DFull listing
Black T-shirt (special edition)

T-Shirt

Black T-shirt (special edition)

Crafted from 100% cotton jersey with a weight of 180 GSM, this t-shirt blends everyday comfort with a bold cultural statement.

Crafted from 100% cotton jersey with a weight of 180 GSM, this t-shirt blends everyday comfort with a bold cultural statement. The front features the Rastah logo in English paired with Urdu typography reading “Made in Pakistan,” while the back carries the unapologetic message: “Better than that European shit you wear” — a tribute to local pride, identity, and self-expression. Key Features: 100% Cotton Jersey, 180 GSM Oversized fit Front: English Rastah logo with Urdu typography Back: “Better than that European shit you wear” statement print Soft-washed finish Care Instructions: Machine wash cold Do not bleach Tumble dry low Iron on low heat Do not dry clean

  • 100% Cotton Jersey, 180 GSM
  • Oversized fit
  • Front: English Rastah logo with Urdu typography
  • Back: “Better than that European shit you wear” statement print
  • Soft-washed finish
  • Machine wash cold
  • Do not bleach
  • Tumble dry low
  • Iron on low heat
  • Do not dry clean
Product type
T-Shirt
Vendor
RESTOCK
Compare at
PKR 84
SKU BLACKT-SHIRT(SPECIALEDITION)-XS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 76

In stock · ready to checkout

View in 3DBuy nowFull listing
Blackout T-shirt

T-Shirt

Blackout T-shirt

A visual storm stitched into cotton.

A visual storm stitched into cotton. Crafted from soft acid-washed cotton, this oversized t-shirt features a minimalist Urdu logo on the front and a powerful, hand-drawn screen-printed artwork by Pakistani artist Maha Farooq on the back — a raw mix of symbols, words, and rebellion that captures a spirit of restless creativity. Key Features: Fabric : 100% cotton, acid-washed for a lived-in texture Color : Faded black/charcoal Fit : Oversized, relaxed silhouette Front : Screen-printed Urdu logo Back : Intricate screen-printed artwork blending South Asian motifs and surreal elements Care Instructions: Wash inside out in cold water Use mild detergent with similar colors Do not bleach Tumble dry low or hang to dry Iron on reverse side if needed (avoid direct heat on print)

  • Fabric : 100% cotton, acid-washed for a lived-in texture
  • Color : Faded black/charcoal
  • Fit : Oversized, relaxed silhouette
  • Front : Screen-printed Urdu logo
  • Back : Intricate screen-printed artwork blending South Asian motifs and surreal elements
  • Wash inside out in cold water
  • Use mild detergent with similar colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on reverse side if needed (avoid direct heat on print)
Product type
T-Shirt
Vendor
STUDIO 54
SKU BLACKOUTTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 106

Currently unavailable

View in 3DFull listing
Block print paisley T-shirt

T-Shirt

Block print paisley T-shirt

The Safar-e-Del Heritage Paisley Tee celebrates the timeless art of South Asia.

The Safar-e-Del Heritage Paisley Tee celebrates the timeless art of South Asia. Made from 100% pure cotton , this off-white oversized tee features a stunning all-over block print with intricate paisley motifs. The back showcases a majestic elephant motif , symbolizing wisdom and strength. A wearable piece of art that blends heritage with modern comfort. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: 100% Pure Cotton: Soft, breathable fabric. Authentic Block Print: All-over intricate paisley design. Majestic Elephant: Detailed motif on the back. Oversized Fit: Contemporary and comfortable style. Logo: screen print. Care Instructions: Dry clean only

  • 100% Pure Cotton: Soft, breathable fabric.
  • Authentic Block Print: All-over intricate paisley design.
  • Majestic Elephant: Detailed motif on the back.
  • Oversized Fit: Contemporary and comfortable style.
  • Logo: screen print.
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU SAFAR-E-DELBLOCKPRINTPAISLEYT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 141

Currently unavailable

View in 3DFull listing
Blockprint fiery rose T-shirt

T-Shirt

Blockprint fiery rose T-shirt

Hand block printed ecru t shirt showcasing one of Rastah’s signature hand painted motifs – “THE FIERY ROSE”.

Hand block printed ecru t shirt showcasing one of Rastah’s signature hand painted motifs – “THE FIERY ROSE”. It is a piece that epitomizes the house’s narrative of continuation through rediscovery. The back of the piece showcases a rectangular block that has been a mainstay in the “jhaandoo” block printing family which is our block printer's family name who have been block printing for four generations. However, they sadly fell off the map as foreigners in Pakistan started to leave the country post 9/11. This piece is an encapsulation of the Pakistani artisan and his struggle to create despite the odds. It is truly a piece “for the artist, from the artist”. 260 gsm heavyweight terry Accrue color Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in black colour Hand block printed and painted using naturally occurring dyes Block printed using wooden blocks passed down across four generations Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.

  • 260 gsm heavyweight terry
  • Accrue color
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in black colour
  • Hand block printed and painted using naturally occurring dyes
  • Block printed using wooden blocks passed down across four generations
  • Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.
Product type
T-Shirt
Vendor
Intermission II
SKU BLOCKPRINTFIERYROSET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 136

Currently unavailable

View in 3DFull listing
Blockprint motif T-shirt

T-Shirt

Blockprint motif T-shirt

This piece, in the same oversized design, comes with a unique touch.

This piece, in the same oversized design, comes with a unique touch. It showcases intricate block printed motifs throughout, handcrafted by Rastah's partner artisans. The front is adorned by the Rastah logo, creating an intriguing piece of wearable art. Key Features: Oversized black T-shirt Block printed motifs handcrafted by artisans Rastah logo on the front Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Oversized black T-shirt
  • Block printed motifs handcrafted by artisans
  • Rastah logo on the front
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU BLOCKPRINTMOTIFTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
Blockprint peacock T-shirt

T-Shirt

Blockprint peacock T-shirt

Hand block printed and hand painted ecru t shirt with a slightly oversized silhouette.

Hand block printed and hand painted ecru t shirt with a slightly oversized silhouette. Showcasing a colorful hand painted peacock on the front which symbolizes royalty and wisdom, it is an ode to the flamboyant and boisterous past of South Asian heritage and dynasties. To this day the animal lives on within artistic mediums of South Asia. The blocks used to make this piece are almost a hundred years old, therefore, a nod to the past, but rediscovered in the present. 260 gsm heavyweight terry Accrue color Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in black colour Hand block printed and painted using naturally occurring dyes Block printed using wooden blocks passed down across four generations Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.

  • 260 gsm heavyweight terry
  • Accrue color
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in black colour
  • Hand block printed and painted using naturally occurring dyes
  • Block printed using wooden blocks passed down across four generations
  • Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.
Product type
T-Shirt
Vendor
Intermission II
SKU BLOCKPRINTPEACOCKT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 136

Currently unavailable

View in 3DFull listing
Blooming tree T-shirt

T-Shirt

Blooming tree T-shirt

This black T-shirt combines graphic expression with layered craftsmanship.

This black T-shirt combines graphic expression with layered craftsmanship. Screen-printed artwork appears on both the front and back, creating a strong visual narrative across the garment. A khaddar fabric patch is layered with a sublimation-printed patch on top, adding texture and depth through contrast. Fashion stitches secure the layers, keeping the construction visible and intentional. Designed with a relaxed silhouette, the piece balances everyday comfort with artisanal detailing, making it a versatile yet expressive wardrobe essential. KEY FEATURES Made from 100% cotton Black base with soft, breathable feel Screen-printed illustrative artwork Khaddar patch with sublimation-printed detailing Hand stitching for artisanal finish Balanced placement of graphic and patchwork Each piece slightly unique due to handmade elements CARE INSTRUCTIONS Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Made from 100% cotton
  • Black base with soft, breathable feel
  • Screen-printed illustrative artwork
  • Khaddar patch with sublimation-printed detailing
  • Hand stitching for artisanal finish
  • Balanced placement of graphic and patchwork
  • Each piece slightly unique due to handmade elements
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
Whispering Walls
SKU BLOOMINGTREET-SHIRTS-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
Blue acid wash made in PAK T-shirt (V4)

T-Shirt

Blue acid wash made in PAK T-shirt (V4)

Experience effortless cool with the Blue Acid Wash Made in Pak T-Shirt .

Experience effortless cool with the Blue Acid Wash Made in Pak T-Shirt . Crafted from lightweight 120 GSM cotton, this tee offers breathable comfort and a relaxed fit for everyday wear. Key Features: Fabric: 120 GSM premium cotton for a soft, airy feel. Color: Distinctive blue acid wash for a unique vintage vibe. Front Detail: Subtle Rastah logo in Urdu on the chest. Back Design: Bold Rastah branding with Urdu typography, accompanied by the crescent moon and star symbol. Fit: Relaxed, oversized silhouette for streetwear appeal. Care Instructions: Machine wash cold with like colors. Tumble dry low or air dry. Avoid ironing directly on the printed areas.

  • Fabric: 120 GSM premium cotton for a soft, airy feel.
  • Color: Distinctive blue acid wash for a unique vintage vibe.
  • Front Detail: Subtle Rastah logo in Urdu on the chest.
  • Back Design: Bold Rastah branding with Urdu typography, accompanied by the crescent moon and star symbol.
  • Fit: Relaxed, oversized silhouette for streetwear appeal.
  • Machine wash cold with like colors.
  • Tumble dry low or air dry.
  • Avoid ironing directly on the printed areas.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLUEACIDWASHMADEINPAKT-SHIRT(V4)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Blue postcard T-shirt

T-Shirt

Blue postcard T-shirt

A classic screen-printed t-shirt crafted for everyday wear.

A classic screen-printed t-shirt crafted for everyday wear. Made from 100% cotton terry , this piece offers a soft, structured feel with added comfort. It features a clean front with a minimal chest graphic and a bold postcard-inspired artwork at the back. The relaxed silhouette and breathable fabric make it an easy essential — comfortable on its own or layered into your daily rotation. Key Features 100% cotton terry fabric Soft looped interior for added comfort Screen-printed graphics on front and back Breathable yet slightly structured hand feel Relaxed fit for everyday wear Durable print suitable for regular use Crew neckline with reinforced stitching Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton terry fabric
  • Soft looped interior for added comfort
  • Screen-printed graphics on front and back
  • Breathable yet slightly structured hand feel
  • Relaxed fit for everyday wear
  • Durable print suitable for regular use
  • Crew neckline with reinforced stitching
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
SS’26
SKU BLUEPOSTCARDT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 66

Currently unavailable

View in 3DFull listing
Blue regular fit embroidered logo T-shirt

T-Shirt

Blue regular fit embroidered logo T-shirt

This White Jersey regular fit T-Shirt brings a fresh, vibrant look with bold blue rib accents on the sleeves and crew neckline.

This White Jersey regular fit T-Shirt brings a fresh, vibrant look with bold blue rib accents on the sleeves and crew neckline. The blue embroidered Rastah logo on the chest adds a touch of cultural flair. This shirt combines comfort and style, making it a perfect choice for casual and streetwear-inspired looks. Fabric Details Material : Soft and breathable jersey fabric, ensuring all-day comfort. Weight : 220 GSM, providing structure while maintaining a lightweight feel. Design Features Blue Ribbed Accents : Contrasting blue ribbing on the sleeves and neckline for a pop of color. Embroidered Logo : Signature blue Rastah logo on the chest for a distinctive touch. Regular Fit : Comfortable and classic fit designed for everyday wear. Fit Fitting : Regular fit, offering a comfortable and relaxed look. Care Instructions Machine wash in cold water on a gentle cycle. Avoid bleach to preserve fabric and logo quality. Air dry to retain the fabric's softness. Use a cool iron on the reverse side if needed.

  • Material : Soft and breathable jersey fabric, ensuring all-day comfort.
  • Weight : 220 GSM, providing structure while maintaining a lightweight feel.
  • Blue Ribbed Accents : Contrasting blue ribbing on the sleeves and neckline for a pop of color.
  • Embroidered Logo : Signature blue Rastah logo on the chest for a distinctive touch.
  • Regular Fit : Comfortable and classic fit designed for everyday wear.
  • Fitting : Regular fit, offering a comfortable and relaxed look.
  • Machine wash in cold water on a gentle cycle.
  • Avoid bleach to preserve fabric and logo quality.
  • Air dry to retain the fabric's softness.
  • Use a cool iron on the reverse side if needed.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BLUEREGULARFITEMBROIDEREDLOGOTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Brick city T-shirt

T-Shirt

Brick city T-shirt

A visual storm stitched into cotton.

A visual storm stitched into cotton. Crafted from soft acid-washed cotton, this oversized t-shirt features a minimalist Urdu logo on the front and a powerful, hand-drawn screen-printed artwork by Pakistani artist Maha Farooq on the back — a raw mix of symbols, words, and rebellion that captures a spirit of restless creativity. Key Features: 100% cotton Acid-washed maroon finish Front: White Urdu logo screen print Back: Large abstract screen-printed graphic Oversized fit with dropped shoulders Care Instructions: Machine wash cold with like colors Wash inside out Tumble dry low or hang dry Iron inside out, avoid direct heat on print

  • 100% cotton
  • Acid-washed maroon finish
  • Front: White Urdu logo screen print
  • Back: Large abstract screen-printed graphic
  • Oversized fit with dropped shoulders
  • Machine wash cold with like colors
  • Wash inside out
  • Tumble dry low or hang dry
  • Iron inside out, avoid direct heat on print
Product type
T-Shirt
Vendor
STUDIO 54
SKU BRICKCITYTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 106

Currently unavailable

View in 3DFull listing
Brown distortion T-shirt

T-Shirt

Brown distortion T-shirt

A bold reinterpretation of summer streetwear.

A bold reinterpretation of summer streetwear. Crafted from 100% cotton, this light blue t-shirt pairs a clean Urdu logo on the front with a vibrant, surrealist-inspired screen-printed illustration by Pakistani artist Maha Farooq on the back. Blending pop-art energy with cultural symbolism, it’s a relaxed piece built for easy everyday expression. Key Features 100% Cotton Screen print at back Urdu logo at front Relaxed, oversized silhouette Care Instructions Machine wash cold with like colors Do not bleach Tumble dry low Iron inside out if needed

  • 100% Cotton
  • Screen print at back
  • Urdu logo at front
  • Relaxed, oversized silhouette
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low
  • Iron inside out if needed
Product type
T-Shirt
Vendor
STUDIO 54
SKU BROWNDISTORTIONT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 106

Currently unavailable

View in 3DFull listing
Brown made in PAK T-shirt (V2)

T-Shirt

Brown made in PAK T-shirt (V2)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. Crafted with meticulous detail, this Brown T-Shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back. Constructed from 220 GSM cotton terry fabric, this shirt boasts a mock neck collar and an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front "Made in Pakistan" in Urdu typography on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Mock neck collar Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • "Made in Pakistan" in Urdu typography on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Mock neck collar
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BROWNMADEINPAKTSHIRT(V2)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Brown made in PAK T-shirt (V6)

T-Shirt

Brown made in PAK T-shirt (V6)

Crafted from soft jersey fabric, the MIP Tee combines everyday comfort with bold visual expression.

Crafted from soft jersey fabric, the MIP Tee combines everyday comfort with bold visual expression. A statement screen-printed graphic on the back adds character, while the clean silhouette and versatile brown tone make it an easy wardrobe staple. Features Soft jersey construction Screen-printed back design Classic crew neckline Relaxed fit Everyday essential Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Do not iron directly on print Wash with similar colors

  • Soft jersey construction
  • Screen-printed back design
  • Classic crew neckline
  • Relaxed fit
  • Everyday essential
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Do not iron directly on print
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU BROWNMADEINPAKT-SHIRT(V6)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Brown made in PAK T-shirt(v1)

T-Shirt

Brown made in PAK T-shirt(v1)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. The brown Rastah Logo T-Shirt blends minimalism with style, featuring the Rastah logo puff printed in English on the front. Made from 220 GSM cotton terry fabric. this t-shirt maintains an oversized fit, providing a relaxed and comfortable silhouette. The fabric is a custom blend made to the specifications of Rastah making it truly unique. Key Features: Rastah logo on the front 220 GSM 100% cotton terry fabric Oversized fit Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small *Please note the colour of this product is what you see in the product images. The colour of the product on the models appear slightly lighter due to studio lighting differences* Washing Instructions: Machine wash in cold water and dry on low heat cycle.

  • Rastah logo on the front
  • 220 GSM 100% cotton terry fabric
  • Oversized fit
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
RESTOCK
SKU BROWNMADEINPAKTSHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Brown sand wash made in PAK T-shirt (V5)

T-Shirt

Brown sand wash made in PAK T-shirt (V5)

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Sand wash Brown tone.

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Sand wash Brown tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton terry Color: Brown Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton terry
  • Color: Brown
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BROWNSANDWASHMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Burnt orange made in PAK T-shirt (V4)

T-Shirt

Burnt orange made in PAK T-shirt (V4)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. This oversized tee is the ultimate fusion of cultural heritage and contemporary design, crafted to elevate your everyday style with effortless sophistication. Design Details: Front : Features a delicate screen print "Rastah" logo in Urdu on the chest and an additional logo on the sleeve, adding refined detail to a minimalist design. Back : Showcases a bold puff-printed "Rastah" logo in English, paired with Urdu typography reading: “Designed in Rastah Studio Lahore | Made in Pakistan” A crescent moon and star symbolize cultural pride and heritage, accompanied by "Established in 2018" for a narrative of authenticity. Key Features: Material : 220 GSM premium cotton for exceptional softness, lightweight breathability, and durability. Fit : Oversized silhouette for a relaxed, modern vibe, ideal for any season. Color : Unique "Burnt orange" shade, blending vibrant energy with earthy sophistication. Craftsmanship : Emphasizes meticulous attention to detail, blending streetwear aesthetics with cultural depth. Care Instructions: Machine wash cold with similar colors. Tumble dry low or hang to dry. Iron on low, avoiding printed and embroidered areas.

  • Front : Features a delicate screen print "Rastah" logo in Urdu on the chest and an additional logo on the sleeve, adding refined detail to a minimalist design.
  • Material : 220 GSM premium cotton for exceptional softness, lightweight breathability, and durability.
  • Fit : Oversized silhouette for a relaxed, modern vibe, ideal for any season.
  • Color : Unique "Burnt orange" shade, blending vibrant energy with earthy sophistication.
  • Craftsmanship : Emphasizes meticulous attention to detail, blending streetwear aesthetics with cultural depth.
  • Machine wash cold with similar colors.
  • Tumble dry low or hang to dry.
  • Iron on low, avoiding printed and embroidered areas.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU BURNTORANGEMADEINPAKT-SHIRT(V4)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Chal bulleya - beige T-shirt

T-Shirt

Chal bulleya - beige T-shirt

The T-shirt is inspired by victorian era design mixed with themes of metamorphosis and rebirth.

The T-shirt is inspired by victorian era design mixed with themes of metamorphosis and rebirth. The garment consists of various hand screen printed design elements on the front and back. slightly oversized fit 200 gsm lightweight cotton/polyester mix Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small *This is a limited edition item. No restocks* *This piece will be launching on the 20th of March at 1pm EST/10pm PAK time. All orders will start to ship from the 25th of March*

  • slightly oversized fit
  • 200 gsm lightweight cotton/polyester mix
  • Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
VOLUME VII
Compare at
PKR 79
SKU CHALBULLEYA-BEIGET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Champion's Edition Tee

T-Shirt

Champion's Edition Tee

Inspired by the legacy of Argentine football and timeless craftsmanship, the Football Base Argentina Heritage T-Shirt merges classic football aesthetics with modern streetwear.

Inspired by the legacy of Argentine football and timeless craftsmanship, the Football Base Argentina Heritage T-Shirt merges classic football aesthetics with modern streetwear. Crafted from premium 100% cotton terry , this oversized tee offers superior softness, breathability, and lasting comfort. Featuring bold screen-printed graphics, heritage-inspired striped panel detailing, and signature Rastah branding, it delivers an elevated everyday essential for football enthusiasts. Key Features Premium 100% Cotton Terry Soft and breathable heavyweight fabric Oversized relaxed fit Raglan sleeve construction Ribbed crew neckline High-quality screen printed artwork Heritage-inspired striped panel design Signature Rastah branding Durable premium construction Soft-touch finish Football-inspired graphics Designed for everyday comfort Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium 100% Cotton Terry
  • Soft and breathable heavyweight fabric
  • Oversized relaxed fit
  • Raglan sleeve construction
  • Ribbed crew neckline
  • High-quality screen printed artwork
  • Heritage-inspired striped panel design
  • Signature Rastah branding
  • Durable premium construction
  • Soft-touch finish
  • Football-inspired graphics
  • Designed for everyday comfort
Product type
T-Shirt
Vendor
NYC Match Day Pop-Up
SKU ARGENTINATSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 158

Currently unavailable

View in 3DFull listing
Charcoal grey made in PAK T-shirt (V1)

T-Shirt

Charcoal grey made in PAK T-shirt (V1)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. The Charcoal Rastah Logo T-Shirt subtly exhibits the Rastah brand, featuring an English Rastah logo on the front and "Made in Pakistan" on the back. Made from 220 GSM cotton terry fabric, this t-shirt is designed with an oversized fit for a comfortable, laid-back style. The fabrication is made entirely custom to Rastah's specifications for a truly unique feel. Key Features: English Rastah logo on the front "Made in Pakistan" on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • English Rastah logo on the front
  • "Made in Pakistan" on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU CHARCOALGREYMADEINPAKT-SHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Charcoal grey made in pak t-shirt (v2)

T-Shirt

Charcoal grey made in pak t-shirt (v2)

This charcoal grey T-shirt features the signature Rastah emblem on the front, paired with “Made in Pakistan” in bold Urdu typography on the back — a statement rooted in culture, craftsmanship, and pride.

This charcoal grey T-shirt features the signature Rastah emblem on the front, paired with “Made in Pakistan” in bold Urdu typography on the back — a statement rooted in culture, craftsmanship, and pride. Constructed from premium 220 GSM cotton jersey, the fabric offers a structured yet breathable feel, giving the tee a clean drape while maintaining everyday comfort. The oversized fit adds a relaxed silhouette, making it versatile for both casual wear and elevated styling. Each piece is garment dyed, creating a rich depth of color with subtle variations that make every shirt unique. Key Features: Signature Rastah logo on the front “Made in Pakistan” in Urdu typography on the back 220 GSM 100% cotton jersey fabric Garment dyed for a rich, lived-in finish Oversized fit for a relaxed silhouette Care Instructions: Machine wash cold with like colors or hand wash with mild detergent Wash inside out to protect prints and patches Do not bleach Tumble dry low or lay flat / hang to dry in the shade Do not iron directly on prints

  • Signature Rastah logo on the front
  • “Made in Pakistan” in Urdu typography on the back
  • 220 GSM 100% cotton jersey fabric
  • Garment dyed for a rich, lived-in finish
  • Oversized fit for a relaxed silhouette
  • Machine wash cold with like colors or hand wash with mild detergent
  • Wash inside out to protect prints and patches
  • Do not bleach
  • Tumble dry low or lay flat / hang to dry in the shade
  • Do not iron directly on prints
Product type
T-Shirt
Vendor
RESTOCK
SKU CHARCOALGREYMADEINPAKT-SHIRT(V2)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 79

In stock · ready to checkout

View in 3DBuy nowFull listing
Cherry made in PAK T-shirt (V1)

T-Shirt

Cherry made in PAK T-shirt (V1)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. The Cherry Rastah Logo T-Shirt subtly exhibits the Rastah brand, featuring an English Rastah logo on the front and "Made in Pakistan" on the back. Made from 220 GSM cotton terry fabric, this t-shirt is designed with an oversized fit for a comfortable, laid-back style. The fabrication is made entirely custom to Rastah's specifications for a truly unique feel. Key Features: English Rastah logo on the front "Made in Pakistan" on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • English Rastah logo on the front
  • "Made in Pakistan" on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU CHERRYMADEINPAKT-SHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Cherry made in PAK T-shirt (V2)

T-Shirt

Cherry made in PAK T-shirt (V2)

This cherry T-shirt features the signature Rastah emblem on the front, paired with “Made in Pakistan” in striking Urdu typography on the back — a statement rooted in culture and craftsmanship.

This cherry T-shirt features the signature Rastah emblem on the front, paired with “Made in Pakistan” in striking Urdu typography on the back — a statement rooted in culture and craftsmanship. Made from premium 220 GSM cotton jersey, the fabric offers a soft, breathable feel with a clean drape, while the mock neck collar adds a refined edge to the silhouette. The oversized fit creates a relaxed, modern look that works effortlessly across everyday wear. Each piece is garment dyed, giving it a rich tone and subtle variations that make every shirt unique. Key Features: Signature Rastah logo on the front “Made in Pakistan” in Urdu typography on the back 220 GSM 100% cotton jersey fabric Garment dyed for a rich, unique finish Oversized fit for a relaxed silhouette Mock neck collar for a structured, elevated look Care Instructions: Machine wash cold with like colors or hand wash with mild detergent Wash inside out to protect prints and patches Do not bleach Tumble dry low or lay flat / hang to dry in the shade Do not iron directly on prints

  • Signature Rastah logo on the front
  • “Made in Pakistan” in Urdu typography on the back
  • 220 GSM 100% cotton jersey fabric
  • Garment dyed for a rich, unique finish
  • Oversized fit for a relaxed silhouette
  • Mock neck collar for a structured, elevated look
  • Machine wash cold with like colors or hand wash with mild detergent
  • Wash inside out to protect prints and patches
  • Do not bleach
  • Tumble dry low or lay flat / hang to dry in the shade
  • Do not iron directly on prints
Product type
T-Shirt
Vendor
RESTOCK
Compare at
PKR 79
SKU CHERRYMADEINPAKT-SHIRT(V2)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 72

In stock · ready to checkout

View in 3DBuy nowFull listing
Cobalt blue embroidered T-shirt

T-Shirt

Cobalt blue embroidered T-shirt

Made from premium cotton jersey, it features a digitally sublimated patch on the front, framed with raw fashion stitches that lend it a handcrafted touch.

Made from premium cotton jersey, it features a digitally sublimated patch on the front, framed with raw fashion stitches that lend it a handcrafted touch. The Urdu calligraphy and celestial illustration evoke a sense of longing and introspection. Multihead embroidery adds tactile depth to the artwork, while the screen-printed Rastah logo on the sleeve completes the design with understated branding. Key Features: Sublimation patch with fashion stitch detailing Multihead embroidery accents on front Screenprinted Rastah logo on sleeve Relaxed, boxy fit Ribbed crew neckline 100% cotton jersey Care Instructions: Hand wash or gentle machine wash in cold water. Wash inside out to protect embroidery and print. Do not bleach. Lay flat or hang to dry in the shade.

  • Sublimation patch with fashion stitch detailing
  • Multihead embroidery accents on front
  • Screenprinted Rastah logo on sleeve
  • Relaxed, boxy fit
  • Ribbed crew neckline
  • 100% cotton jersey
Product type
T-Shirt
Vendor
BFCM 2025
SKU BLUESUBLIMATIONPATCHEMBROIDEREDT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
Cow Boy Acid Wash T-shirt

T-Shirt

Cow Boy Acid Wash T-shirt

Crafted from soft jersey fabric, the Graphic Tee is finished with a black acid wash treatment for a distinctive worn-in look.

Crafted from soft jersey fabric, the Graphic Tee is finished with a black acid wash treatment for a distinctive worn-in look. The statement graphic adds visual character, while the relaxed silhouette ensures everyday comfort and effortless versatility. Features Soft jersey construction Black acid wash finish Graphic print detail Classic crew neckline Relaxed fit Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Do not iron directly on print Wash with similar colors

  • Soft jersey construction
  • Black acid wash finish
  • Graphic print detail
  • Classic crew neckline
  • Relaxed fit
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Do not iron directly on print
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU AWAARAACIDWASHT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

In stock · ready to checkout

View in 3DBuy nowFull listing
Cream jacquard raglan full-sleeve shirt (V5)

T-Shirt

Cream jacquard raglan full-sleeve shirt (V5)

An airy off-white sweatshirt crafted from 100% cotton, featuring a relaxed silhouette with raglan sleeves.

An airy off-white sweatshirt crafted from 100% cotton, featuring a relaxed silhouette with raglan sleeves. Finished with a front pocket that holds the screen-printed Urdu "Rastah" logo — subtle, utilitarian, and culture-forward. Key Features: 100% cotton Color: Off-white Raglan sleeves Front pocket with screen-printed Urdu logo Relaxed oversized fit Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang dry Iron on low inside out, avoiding the print

  • 100% cotton
  • Color: Off-white
  • Raglan sleeves
  • Front pocket with screen-printed Urdu logo
  • Relaxed oversized fit
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang dry
  • Iron on low inside out, avoiding the print
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU CREAMJACQUARDRAGLANFULLSLEEVESHIRT(V5)-XS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 106

In stock · ready to checkout

View in 3DBuy nowFull listing
Cream jacquard raglan T-shirt (V5)

T-Shirt

Cream jacquard raglan T-shirt (V5)

An airy off-white t-shirt crafted from 100% cotton, featuring a relaxed silhouette with raglan sleeves.

An airy off-white t-shirt crafted from 100% cotton, featuring a relaxed silhouette with raglan sleeves. Finished with a front pocket that holds the screen-printed Urdu "Rastah" logo — subtle, utilitarian, and culture-forward. Key Features: 100% cotton Color: Off-white Raglan sleeves Front pocket with screen-printed Urdu logo Relaxed oversized fit Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang dry Iron on low inside out, avoiding the print

  • 100% cotton
  • Color: Off-white
  • Raglan sleeves
  • Front pocket with screen-printed Urdu logo
  • Relaxed oversized fit
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang dry
  • Iron on low inside out, avoiding the print
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU CREAMJACQUARDRAGLANTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 163

Currently unavailable

View in 3DFull listing
Crème made in PAK JR T-shirt (V6)

T-Shirt

Crème made in PAK JR T-shirt (V6)

An everyday essential designed for effortless comfort and timeless style.

An everyday essential designed for effortless comfort and timeless style. The Beige made in PAK JR T-shirt (V6) is crafted from premium jersey fabric with a soft hand feel and breathable construction. Featuring a clean crew neckline and subtle Made in Pakistan chest embroidery, this minimalist tee is perfect for daily wear and easy layering. Features Premium jersey fabric Soft, breathable, and lightweight Classic crew neckline Comfortable regular fit Signature MIP (Made in Pakistan) chest embroidery Durable construction for everyday wear Minimalist design with versatile styling Care Guide Machine wash cold with similar colors Wash inside out Do not bleach Tumble dry low or line dry Warm iron if needed (avoid embroidery) Do not dry clean

  • Premium jersey fabric
  • Soft, breathable, and lightweight
  • Classic crew neckline
  • Comfortable regular fit
  • Signature MIP (Made in Pakistan) chest embroidery
  • Durable construction for everyday wear
  • Minimalist design with versatile styling
  • Machine wash cold with similar colors
  • Wash inside out
  • Do not bleach
  • Tumble dry low or line dry
  • Warm iron if needed (avoid embroidery)
Product type
T-Shirt
Vendor
CORE V6
SKU CREMEMADEINPAKJRT-SHIRT(V6)-L-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 62

In stock · ready to checkout

View in 3DBuy nowFull listing
CRÈME made in Pak Tshirt V(6)

T-Shirt

CRÈME made in Pak Tshirt V(6)

Inspired by the vibrant street culture and iconic signboards of Lahore, the Lahore Signage Oversized Tee blends heritage-inspired graphics with modern streetwear aesthetics.

Inspired by the vibrant street culture and iconic signboards of Lahore, the Lahore Signage Oversized Tee blends heritage-inspired graphics with modern streetwear aesthetics. Crafted from premium cotton in a relaxed oversized silhouette, it features a minimalist chest logo on the front and a bold retro-style graphic on the back. Designed for comfort and self-expression, this statement piece pays homage to the city's timeless character while delivering everyday versatility. Features Premium heavyweight cotton construction Relaxed oversized fit for enhanced comfort Soft and breathable fabric Minimal embroidered/printed chest logo Large vintage-inspired Lahore signage graphic on the back Ribbed crew neckline for durability Dropped shoulders for a contemporary silhouette Cream colorway with retro-inspired artwork Ideal for casual and streetwear styling Care Guide Machine wash cold with similar colors Wash inside out to preserve graphic quality Do not bleach Do not dry clean Tumble dry low or hang dry Cool iron on reverse side only Avoid ironing directly on the print Store folded in a cool, dry place

  • Premium heavyweight cotton construction
  • Relaxed oversized fit for enhanced comfort
  • Soft and breathable fabric
  • Minimal embroidered/printed chest logo
  • Large vintage-inspired Lahore signage graphic on the back
  • Ribbed crew neckline for durability
  • Dropped shoulders for a contemporary silhouette
  • Cream colorway with retro-inspired artwork
  • Ideal for casual and streetwear styling
  • Machine wash cold with similar colors
  • Wash inside out to preserve graphic quality
  • Do not bleach
Product type
T-Shirt
Vendor
CORE V6
SKU CREAMMADEINPAKT-SHIRT(V6)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Dastakari block print T-shirt

T-Shirt

Dastakari block print T-shirt

Crafted from 100% cotton, this hand blockprinted shirt draws from folkloric visual language — featuring trailing vines, flora, and a crane motif that wraps around the body.

Crafted from 100% cotton, this hand blockprinted shirt draws from folkloric visual language — featuring trailing vines, flora, and a crane motif that wraps around the body. The borders mirror traditional South Asian textile aesthetics, while a screen-printed patch on the chest adds a quiet layer of contrast and modernity. Both wearable and symbolic, this shirt becomes a canvas of myth, ritual, and protection. Key Features: 220 GSM 100% cotton terry Hand blockprinted detailing front and back Crane, floral & vine motif Screen-printed patch at chest Relaxed, oversized silhouette Traditional border framing on sleeves and hem Drop shoulder construction Care Instructions: Dry Clean Only

  • 220 GSM 100% cotton terry
  • Hand blockprinted detailing front and back
  • Crane, floral & vine motif
  • Screen-printed patch at chest
  • Relaxed, oversized silhouette
  • Traditional border framing on sleeves and hem
  • Drop shoulder construction
  • Dry Clean Only
Product type
T-Shirt
Vendor
UNLUCKY CHARMS
Compare at
PKR 176
SKU DASTAKARIBLOCKPRINTT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
Deep maroon logo T-shirt

T-Shirt

Deep maroon logo T-shirt

Lightweight and oversized t shirt with Rastah's monogram printed on the front.

Lightweight and oversized t shirt with Rastah's monogram printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 19th of June. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
Summer Essentials Drop 01
SKU DEEPMAROONLOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 58

Currently unavailable

View in 3DFull listing
Deep ocean made in PAK T-shirt (V5)

T-Shirt

Deep ocean made in PAK T-shirt (V5)

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Deep Ocean tone.

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Deep Ocean tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton terry Color: Deep Ocean Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton terry
  • Color: Deep Ocean
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU DEEPOCEANMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 93

In stock · ready to checkout

View in 3DBuy nowFull listing
Digink collab "islamabad and I" T-shirt

T-Shirt

Digink collab "islamabad and I" T-shirt

Yet another collaboration between the house and renowned Pakistani digital artist "Digink".

Yet another collaboration between the house and renowned Pakistani digital artist "Digink". This piece holds great sentimental value for Digink, as it is an abstract, yet narrative representation of the artists relationship with the city they grew up in - Islamabad. The black and white portion depict the artist and their friends, whereas the outer box consists of different elements within the city of Islamabad. The front of the garment contains a vertical strip of screen printed text in Urdu, which translates to "The evening of sorrows is long, but, it too shall pass like any other evening" *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah Volume V monogram screen printed on front hand screen printed artwork on the back Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6'1 ; wearing: Medium | Female Model: 5'7; Wearing small

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah Volume V monogram screen printed on front
  • hand screen printed artwork on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6'1 ; wearing: Medium | Female Model: 5'7; Wearing small
Product type
T-Shirt
Vendor
VOLUME V
SKU DIGINKCOLLABISLAMABADANDIT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Digink melting patch acid wash T-shirt

T-Shirt

Digink melting patch acid wash T-shirt

For Volume IV, Rastah re-examines its basics and presents elevated garments with greater depth and dimension.

For Volume IV, Rastah re-examines its basics and presents elevated garments with greater depth and dimension. This acid wash vintage grey Volume IV exclusive crew neck t-shirt was acid washed in-house to give it a faded texture. The garment includes two patches on the front, with one stitched atop the other. This marks the house's third collaboration with popular graphic designer, "Digink". The artwork showcases tradition truck art motifs constructed within a unique composition and offset with certain parts in black and white. This affect was purposefully created to elude to the misrepresented nature of Pakistan's much celebrated hand painted Bedford trucks. *THIS IS A LIMITED EDITION ITEM WHICH WILL NOT BE RESTOCKED ONCE SOLD OUT* Slightly oversized fit Dropped shoulders 270 GSM compact combed terry “Rastah” Volume IV patch 80/20 Cotton: Polyester ratio Printed Khaddar fabric patch on the front Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10; Wearing Medium | Female Model: 5'7; Wearing Small

  • Slightly oversized fit
  • Dropped shoulders
  • 270 GSM compact combed terry
  • “Rastah” Volume IV patch
  • 80/20 Cotton: Polyester ratio
  • Printed Khaddar fabric patch on the front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10; Wearing Medium | Female Model: 5'7; Wearing Small
Product type
T-Shirt
Vendor
VOLUME IV
SKU DIGINKMELTINGPATCHACIDWASHT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Disco deewane beige T-shirt

T-Shirt

Disco deewane beige T-shirt

Drops 05/22, ships 05/25.

Drops 05/22, ships 05/25. This piece is inspired by 90's Pakistani pop music songs and every cassette on the back has a nostalgic reference infused within i, such as “Ajnabi by Vital Signs”, “Sar kiye yeh pahar" by Strings just to name a few. The garment itself has hand screen printed elements on the front and back. slightly oversized fit 280 gsm terry in a cotton and polyester mix Reimagined Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 280 gsm terry in a cotton and polyester mix
  • Reimagined Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
MAY CAPSULE
SKU DISCODEEWANEBEIGET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 84

Currently unavailable

View in 3DFull listing
Doodle bloom digital print shirt

T-Shirt

Doodle bloom digital print shirt

Doodle Bloom captures the spirit of spontaneity through vibrant strokes on a soft black canvas.

Doodle Bloom captures the spirit of spontaneity through vibrant strokes on a soft black canvas. Made from digitally printed silk, it blends fluid comfort with playful patterns and cultural storytelling. The relaxed button-down silhouette features a bold graphic back — a tribute to nostalgia, street art, and everyday symbolism. A lightweight summer essential rooted in art and identity. Key Features: Digitally printed lightweight silk fabric Abstract multicolor doodle-style design Bold back print inspired by vintage posters and cultural motifs Relaxed fit with button-down front Open Cuban collar for a breezy summer look Care Instructions: Hand wash cold or machine wash on delicate cycle Wash with like colors Do not bleach Hang to dry or tumble dry low Iron on low heat, inside out Avoid dry cleaning to preserve digital print

  • Digitally printed lightweight silk fabric
  • Abstract multicolor doodle-style design
  • Bold back print inspired by vintage posters and cultural motifs
  • Relaxed fit with button-down front
  • Open Cuban collar for a breezy summer look
  • Hand wash cold or machine wash on delicate cycle
  • Wash with like colors
  • Do not bleach
  • Hang to dry or tumble dry low
  • Iron on low heat, inside out
  • Avoid dry cleaning to preserve digital print
Product type
T-Shirt
Vendor
Naqsh-e-Rooh
SKU DOODLEBLOOMDIGITALPRINTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 176

Currently unavailable

View in 3DFull listing
Dystopian ode to Lahore T-shirt

T-Shirt

Dystopian ode to Lahore T-shirt

A juxtaposition of experimental design through dystopian thread work and a popular Urdu reference to the city of Lahore – “Lahore Lahore Ay”.

A juxtaposition of experimental design through dystopian thread work and a popular Urdu reference to the city of Lahore – “Lahore Lahore Ay”. The details on the front are all done by hand and the text on the back is hand machine embroidered. The t shirt is an ode to the iconic Pakistani song “Lahore Lahore Aye” by Tariq Tafu, which is now one of the most famous catch phrases within the city. Despite its chaotic elements and structure, the city remains one of the most vibrant and prominent jewels of South Asia. This piece encapsulates the spirit of harmony even amongst sheer chaos. 300 gsm heavyweight fleece Earth green colour Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in black colour Hand embroidered multi-colour thread detailing on front panel Hand machine embroidered phrase – “Lahore Lahore Aye” using a thick acrylic thread on the back panel Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.

  • 300 gsm heavyweight fleece
  • Earth green colour
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in black colour
  • Hand embroidered multi-colour thread detailing on front panel
  • Hand machine embroidered phrase – “Lahore Lahore Aye” using a thick acrylic thread on the back panel
  • Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.
Product type
T-Shirt
Vendor
Intermission II
SKU DYSTOPIANODETOLAHORET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 101

Currently unavailable

View in 3DFull listing
Echoes of the past black T-shirt

T-Shirt

Echoes of the past black T-shirt

Echos of the past’s design style is inspired by old Aztec hieroglyphics.

Echos of the past’s design style is inspired by old Aztec hieroglyphics. The design itself depicts how standing your ground and facing your struggles can lead to inner growth, how you may find your oasis in the harsh desert. The garment itself is hand screen printed with puff paint. slightly oversized fit 200 gsm lightweight cotton/polyester mix t shirt Rastah logo printed on the front hand screen and puff printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small *This is a limited edition item. No restocks* *This piece will be launching on the 20th of March at 1pm EST/10pm PAK time. All orders will start to ship from the 25th of March*

  • slightly oversized fit
  • 200 gsm lightweight cotton/polyester mix t shirt
  • Rastah logo printed on the front
  • hand screen and puff printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
VOLUME VII
Compare at
PKR 79
SKU ECHOSOFTHEPASTBLACKT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Embroidered beige made in PAK T-shirt (V1)

T-Shirt

Embroidered beige made in PAK T-shirt (V1)

This T-shirt is a minimalist yet sophisticated piece from our Core collection.

This T-shirt is a minimalist yet sophisticated piece from our Core collection. Crafted from 100% premium cotton with a substantial 230 GSM weight, this t-shirt guarantees exceptional comfort and durability. The subtle, beige-on-beige embroidery of the Rastah logo on both the front and back adds a refined, 3D effect, elevating the overall aesthetic. The oversized fit ensures a relaxed and contemporary silhouette, making it a versatile addition to your wardrobe. Perfect for casual outings or layering, this t-shirt embodies understated elegance and timeless design. Key Features: Material: 100% premium cotton, 230 GSM Color: Beige Design: Subtle beige-on-beige embroidered Rastah logos for a 3D effect Fit: Oversized for a relaxed silhouette Care Instructions: Machine wash cold Wash inside out Gentle cycle with like colors Do not bleach Tumble dry low Iron on low heat if needed Do not dry clean Model Information: The male model is 5'11" and wears a size Medium. The female model is 5'7" and wears a size Small.

  • Material: 100% premium cotton, 230 GSM
  • Color: Beige
  • Design: Subtle beige-on-beige embroidered Rastah logos for a 3D effect
  • Fit: Oversized for a relaxed silhouette
  • Machine wash cold
  • Wash inside out
  • Gentle cycle with like colors
  • Do not bleach
  • Tumble dry low
  • Iron on low heat if needed
  • Do not dry clean
  • The male model is 5'11" and wears a size Medium.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU EMBROIDEREDBEIGEMADEINPAKT-SHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

In stock · ready to checkout

View in 3DBuy nowFull listing
Embroidered beige made in PAK T-shirt (V2)

T-Shirt

Embroidered beige made in PAK T-shirt (V2)

This T-shirt is a minimalist yet sophisticated piece from our Core collection.

This T-shirt is a minimalist yet sophisticated piece from our Core collection. Crafted from 100% premium cotton with a substantial 230 GSM weight, this t-shirt guarantees exceptional comfort and durability. The subtle, beige-on-beige embroidery of the Rastah logo on both the front and back adds a refined, 3D effect, elevating the overall aesthetic. The oversized fit ensures a relaxed and contemporary silhouette, making it a versatile addition to your wardrobe. Perfect for casual outings or layering, this t-shirt embodies understated elegance and timeless design. Key Features: Material: 100% premium cotton, 230 GSM Color: Beige Design: Subtle beige-on-beige embroidered Rastah logos for a 3D effect, Urdu typography on back Fit: Oversized for a relaxed silhouette Care Instructions: Machine wash cold Wash inside out Gentle cycle with like colors Do not bleach Tumble dry low Iron on low heat if needed Do not dry clean Model Information: The male model is 5'11" and wears a size Medium. The female model is 5'7" and wears a size Small.

  • Material: 100% premium cotton, 230 GSM
  • Color: Beige
  • Design: Subtle beige-on-beige embroidered Rastah logos for a 3D effect, Urdu typography on back
  • Fit: Oversized for a relaxed silhouette
  • Machine wash cold
  • Wash inside out
  • Gentle cycle with like colors
  • Do not bleach
  • Tumble dry low
  • Iron on low heat if needed
  • Do not dry clean
  • The male model is 5'11" and wears a size Medium.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU EMBROIDEREDBEIGEMADEINPAKT-SHIRT(V2)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Embroidered black made in PAK T-shirt (V1)

T-Shirt

Embroidered black made in PAK T-shirt (V1)

This T-shirt is a minimalist yet sophisticated piece from our Core collection.

This T-shirt is a minimalist yet sophisticated piece from our Core collection. Crafted from 100% premium cotton with a substantial 230 GSM weight, this t-shirt guarantees exceptional comfort and durability. The subtle, black-on-black embroidery of the Rastah logo on both the front and back adds a refined, 3D effect, elevating the overall aesthetic. The oversized fit ensures a relaxed and contemporary silhouette, making it a versatile addition to your wardrobe. Perfect for casual outings or layering, this t-shirt embodies understated elegance and timeless design. Key Features: Material: 100% premium cotton, 230 GSM Color: Beige Design: Subtle black-on-black embroidered Rastah logos for a 3D effect Fit: Oversized for a relaxed silhouette Care Instructions: Machine wash cold Wash inside out Gentle cycle with like colors Do not bleach Tumble dry low Iron on low heat if needed Do not dry clean Model Information: The male model is 5'11" and wears a size Medium. The female model is 5'7" and wears a size Small.

  • Material: 100% premium cotton, 230 GSM
  • Color: Beige
  • Design: Subtle black-on-black embroidered Rastah logos for a 3D effect
  • Fit: Oversized for a relaxed silhouette
  • Machine wash cold
  • Wash inside out
  • Gentle cycle with like colors
  • Do not bleach
  • Tumble dry low
  • Iron on low heat if needed
  • Do not dry clean
  • The male model is 5'11" and wears a size Medium.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU EMBROIDEREDBLACKMADEINPAKT-SHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Embroidered black made in PAK T-shirt (V2)

T-Shirt

Embroidered black made in PAK T-shirt (V2)

This T-shirt is a minimalist yet sophisticated piece from our Core collection.

This T-shirt is a minimalist yet sophisticated piece from our Core collection. Crafted from 100% premium cotton with a substantial 230 GSM weight, this t-shirt guarantees exceptional comfort and durability. The subtle, black-on-black embroidery of the Rastah logo on both the front and back adds a refined, 3D effect, elevating the overall aesthetic. The oversized fit ensures a relaxed and contemporary silhouette, making it a versatile addition to your wardrobe. Perfect for casual outings or layering, this t-shirt embodies understated elegance and timeless design. Key Features: Material: 100% premium cotton, 230 GSM Color: Beige Design: Subtle black-on-black embroidered Rastah logos for a 3D effect, Urdu typography on back Fit: Oversized for a relaxed silhouette Care Instructions: Machine wash cold Wash inside out Gentle cycle with like colors Do not bleach Tumble dry low Iron on low heat if needed Do not dry clean Model Information: The male model is 5'11" and wears a size Medium. The female model is 5'7" and wears a size Small.

  • Material: 100% premium cotton, 230 GSM
  • Color: Beige
  • Design: Subtle black-on-black embroidered Rastah logos for a 3D effect, Urdu typography on back
  • Fit: Oversized for a relaxed silhouette
  • Machine wash cold
  • Wash inside out
  • Gentle cycle with like colors
  • Do not bleach
  • Tumble dry low
  • Iron on low heat if needed
  • Do not dry clean
  • The male model is 5'11" and wears a size Medium.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU EMBROIDEREDBLACKMADEINPAKT-SHIRT(V2)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Embroidered patchwork T-shirt

T-Shirt

Embroidered patchwork T-shirt

Made from soft, acid-washed cotton, the t-shirt features a central multihead embroidery patch depicting a hand-drawn nightscape of pine trees under a crescent moon.

Made from soft, acid-washed cotton, the t-shirt features a central multihead embroidery patch depicting a hand-drawn nightscape of pine trees under a crescent moon. A subtle screen-printed Urdu logo graces the sleeve, grounding this celestial piece in cultural identity. Key Features: 100% cotton fabric with acid wash finish Multihead embroidered scenic patch on front Screen-printed Urdu logo on sleeve Relaxed fit for all-day comfort Ribbed neckline for structure Care Instructions: Hand or machine wash cold, inside out, with mild detergent. Do not bleach. Tumble dry low or hang to dry. Iron inside out on low heat, avoiding embroidery.

  • 100% cotton fabric with acid wash finish
  • Multihead embroidered scenic patch on front
  • Screen-printed Urdu logo on sleeve
  • Relaxed fit for all-day comfort
  • Ribbed neckline for structure
Product type
T-Shirt
Vendor
BFCM 2025
SKU SITARONKAJUNGLET-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Emerald made in PAK T-shirt (V6)

T-Shirt

Emerald made in PAK T-shirt (V6)

Crafted from premium jersey fabric, the MIP Tee is designed for effortless everyday wear.

Crafted from premium jersey fabric, the MIP Tee is designed for effortless everyday wear. The clean construction is complemented by subtle signature branding, creating a versatile staple with a refined finish. Features Soft jersey construction Signature logo detail Classic crew neckline Relaxed fit Everyday essential design Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Warm iron if needed Wash with similar colors

  • Soft jersey construction
  • Signature logo detail
  • Classic crew neckline
  • Relaxed fit
  • Everyday essential design
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Warm iron if needed
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU EMERALDGREENMADEINPAKT-SHIRT(V6)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Eye of the storm - beige T-shirt

T-Shirt

Eye of the storm - beige T-shirt

Even though the name suggests a storm which normally represents chaos this piece is the most minimal design from the collection, the design elements only use black and a bit of red color.

Even though the name suggests a storm which normally represents chaos this piece is the most minimal design from the collection, the design elements only use black and a bit of red color. The overall design is a minimal take on how when there is will one can even find their way through the storm. The design has and screen printed elements throughout. slightly oversized fit 200 gsm heavyweight fleece in a cotton and polyester mix Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small *THIS COLLECTION WILL BE AVAILABLE ON THE 21st FOR SALE AND WILL BE SHIPPED ON THE 23rd*

  • slightly oversized fit
  • 200 gsm heavyweight fleece in a cotton and polyester mix
  • Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
INTERMISSION VI
Compare at
PKR 86
SKU EYEOFTHESTORM-BEIGET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 86

Currently unavailable

View in 3DFull listing
Faded matcha stone wash made in PAK T-shirt (V5)

T-Shirt

Faded matcha stone wash made in PAK T-shirt (V5)

An oversized t-shirt crafted from 100% cotton terry fabric in a Stone wash green tone.

An oversized t-shirt crafted from 100% cotton terry fabric in a Stone wash green tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton terry Color: Faded matcha Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton terry
  • Color: Faded matcha
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU FADEDMATCHASTONEWASHMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 93

In stock · ready to checkout

View in 3DBuy nowFull listing
Faded teal acid wash made in PAK T-shirt (V5)

T-Shirt

Faded teal acid wash made in PAK T-shirt (V5)

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Acid Wash tone.

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Acid Wash tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton terry Color: Faded Teal Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton terry
  • Color: Faded Teal
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU FADEDTEALACIDWASHMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Fertility mock neck shirt

T-Shirt

Fertility mock neck shirt

This mock neck represents a movement and the right to fight for our bodily autonomy.

This mock neck represents a movement and the right to fight for our bodily autonomy. The right to express as freely and the right to make our own choices. This shirt represents the importance of body autonomy, to govern our bodies with love and care, without any external coercion or man made rules and moral policing. slightly oversized fit 200 gsm heavyweight fleece in a cotton and polyester mix Rastah logo printed on the front in Sanskrit hand screen printed details on the front Mock neck Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small *THIS COLLECTION WILL BE AVAILABLE ON THE 21st FOR SALE AND WILL BE SHIPPED ON THE 23rd*

  • slightly oversized fit
  • 200 gsm heavyweight fleece in a cotton and polyester mix
  • Rastah logo printed on the front in Sanskrit
  • hand screen printed details on the front
  • Mock neck
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
INTERMISSION VI
Compare at
PKR 88
SKU FERTILITYMOCKNECKSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
FIFA T SHIRT PINK AND CREAM PANNELS

T-Shirt

FIFA T SHIRT PINK AND CREAM PANNELS

FIFA T SHIRT PINK AND CREAM PANNELS

FIFA T SHIRT PINK AND CREAM PANNELS from official Rastah storefront.

  • T-Shirt
  • NYC Match Day Pop-Up
Product type
T-Shirt
Vendor
NYC Match Day Pop-Up
SKU FIFATSHIRTPINKANDCREAMPANNELS-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 158

Currently unavailable

View in 3DFull listing
Flight after fire T-shirt

T-Shirt

Flight after fire T-shirt

The Flight After Fire T-Shirt is crafted from 100% cotton terry, 220 GSM , featuring a paneled raglan construction that creates a relief-like surface across the body.

The Flight After Fire T-Shirt is crafted from 100% cotton terry, 220 GSM , featuring a paneled raglan construction that creates a relief-like surface across the body. Ajrak-printed fabric panels run along the sleeves, while a hand-appliquéd parrot at the front references a Tutinama tale of departure and consequence—movement that follows destruction, not before it. Key Features 100% cotton terry, 220 GSM Paneled raglan construction Ajrak-printed fabric panels along sleeves Hand-appliquéd parrot motif at front Visible hand stitching on appliqué Regular fit for everyday wear Handcrafted detailing with slight variations Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect appliqué and printed panels Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton terry, 220 GSM
  • Paneled raglan construction
  • Ajrak-printed fabric panels along sleeves
  • Hand-appliquéd parrot motif at front
  • Visible hand stitching on appliqué
  • Regular fit for everyday wear
  • Handcrafted detailing with slight variations
Product type
T-Shirt
Vendor
TUTINAMA
SKU RASTAH-10388676903224

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 220

Currently unavailable

View in 3DFull listing
Fly To Lahore T-Shirt

T-Shirt

Fly To Lahore T-Shirt

Lahore is a city that invites you to come and then makes it hard to leave.

Lahore is a city that invites you to come and then makes it hard to leave. It operates at a frequency that gets into you — the food, the music, the old city lanes, the way the light falls in the late afternoon on Mughal brick. The Fly To Lahore T-Shirt is an open invitation: a garment that tells you where to go and dresses you well enough to arrive. The base is an acid-wash terracotta jersey — a colour that references the city's brick and soil, treated to have the worn quality of something that has already been through the day. Traditional motifs are laser-cut from khaddar and applied to the shirt surface, the negative space of the laser cut as much a part of the design as the solid motif. A screen-printed RASTAH logo on a khaddar patch marks the chest. The back carries a full screen-print artwork composition. Acid wash terracotta is a specific decision — it resists the safe neutrals and the obvious brights, sitting in the register of earth and brick and old plaster. The laser-cut khaddar motifs in traditional forms are both decorative and declarative: this is where this shirt comes from, this is what it's pointing toward. Every city has its frequency. Lahore's is a particular one — loud, layered, generous, old. This shirt is tuned to it. Key Features Acid-wash terracotta jersey construction Laser-cut traditional motifs in khaddar applied to surface Screen-printed RASTAH logo on khaddar patch at chest Screen-printed back artwork Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Acid-wash terracotta jersey construction
  • Laser-cut traditional motifs in khaddar applied to surface
  • Screen-printed RASTAH logo on khaddar patch at chest
  • Screen-printed back artwork
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
SKU FLYTOLAHORET-SHIRT-M-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 123

In stock · ready to checkout

View in 3DBuy nowFull listing
Fresh prince of bani gala - T-shirt

T-Shirt

Fresh prince of bani gala - T-shirt

Drops 05/22, ships 05/25.

Drops 05/22, ships 05/25. This piece takes inspiration from the 90’s pop culture TV show “Fresh prince of Bel Air”, but with a Rastah twist on it. The Logo on the front is inspired by the infamous Mtv logo and text on the back reads “The fresh prince of Bani Gala” rather than the original name of the TV show. The garment consists of various hand screen printed design elements, and two patches on the back with Urdu text on them that read “Today at 10 pm, Only on Rastah Television”. slightly oversized fit 280 gsm terry in a cotton and polyester mix Reimagined Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 280 gsm terry in a cotton and polyester mix
  • Reimagined Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
MAY CAPSULE
Compare at
PKR 84
SKU FRESHPRINCEOFBANIGALA-T-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 84

Currently unavailable

View in 3DFull listing
Friends & family patchwork T-shirt

T-Shirt

Friends & family patchwork T-shirt

The Loyalty T-Shirt is constructed as a layered composition of textile memories.

The Loyalty T-Shirt is constructed as a layered composition of textile memories. Set on a deep black 220 GSM 100% cotton terry base, the garment is elevated through carefully placed patchwork panels that feel archival and personal. Across the front and back, multiple fabric fragments are appliquéd with visible stitching and raw edges. These include jacquard-woven panels with intricate traditional motifs, digitally printed artwork patches, vintage-inspired “Friends & Family 01–33” label detailing, and Urdu calligraphy elements that reinforce identity and belonging. Some patches feature distressed finishes and frayed threads, intentionally left exposed to celebrate craft and imperfection. The numbering detail strengthens the concept of exclusivity, positioning each piece within a limited sequence rather than mass production. Every garment carries slight variation in patch placement and texture, making each one subtly unique. This piece is designed to feel collected over time — layered, meaningful, and rooted in loyalty. Key Features 220 GSM 100% cotton terry base Relaxed fit silhouette Multi-layer patchwork construction on front, back, and sleeves Jacquard-woven fabric panels with traditional motifs Digitally printed artwork patches Urdu calligraphy patch detailing “Friends & Family 01–33” archival-style label patch Raw-edge, distressed appliqué finish with visible stitching Limited numbering detail Made in Pakistan Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patches and prints Do not bleach Lay flat or hang to dry in the shade

  • 220 GSM 100% cotton terry base
  • Relaxed fit silhouette
  • Multi-layer patchwork construction on front, back, and sleeves
  • Jacquard-woven fabric panels with traditional motifs
  • Digitally printed artwork patches
  • Urdu calligraphy patch detailing
  • “Friends & Family 01–33” archival-style label patch
  • Raw-edge, distressed appliqué finish with visible stitching
  • Limited numbering detail
  • Made in Pakistan
Product type
T-Shirt
Vendor
F&F BATCH 3
SKU FRIENDS&FAMILYPATCHWORKT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
Friends & Family Patchwork T-Shirt

T-Shirt

Friends & Family Patchwork T-Shirt

The Friends & Family Patchwork T-Shirt is crafted from jersey fabric, combining contemporary streetwear aesthetics with handcrafted textile techniques.

The Friends & Family Patchwork T-Shirt is crafted from jersey fabric, combining contemporary streetwear aesthetics with handcrafted textile techniques. Designed with a relaxed silhouette, the piece features direct block printing throughout, adding depth and an artisanal character to the garment. The t-shirt is detailed with sublimation jute patches that are overlocked onto the surface, creating a layered patchwork effect on the back with jacquard fabric patches. One sublimation patch features the phrase “Khas Logon K Liye” (for special people) , while another highlights the Friends & Family artwork and the third one showcases artwork inspired by Pakistani heritage, adding a cultural and storytelling element to the garment — “yaadon, riwayat aur apnayat se judi hui kahani” (a story connected to memories, heritage, and belonging) . Crystal hand embellishments are randomly scattered and stitched across the garment, adding texture, dimension, and a subtle reflective finish. Jersey fabric patches featuring block print motifs are layered onto the shirt, reinforcing the mixed-media construction and handcrafted feel of the piece. A sublimation jute patch on the sleeve features a personalized name initial and is finished with fashion stitches, created exclusively for loyal members to make them feel special, valued, and appreciated — “sirf un logon ke liye jo dil ke kareeb hain” (only for the people closest to the heart) . The piece is completed with a directly screen-printed logo on the front, balancing traditional craftsmanship with contemporary streetwear design. Key Features Jersey fabric construction Relaxed t-shirt silhouette Direct block printing throughout Sublimation jute patches with overlock detailing on the back Layered jacquard fabric patchwork Crystal hand embellishments stitched randomly across the garment Jersey fabric patches with block print motifs Khas Logon K Liye sublimation artwork patch Friends & Family artwork patch Pakistani heritage-inspired artwork patch Personalized sublimation jute initial patch on sleeve Fashion stitch detailing Direct screen-printed logo on front Mixed-media handcrafted construction Contemporary streetwear aesthetic with artisanal detailing Care Instructions Dry clean only

  • Jersey fabric construction
  • Relaxed t-shirt silhouette
  • Direct block printing throughout
  • Sublimation jute patches with overlock detailing on the back
  • Layered jacquard fabric patchwork
  • Crystal hand embellishments stitched randomly across the garment
  • Jersey fabric patches with block print motifs
  • Khas Logon K Liye sublimation artwork patch
  • Friends & Family artwork patch
  • Pakistani heritage-inspired artwork patch
  • Personalized sublimation jute initial patch on sleeve
  • Fashion stitch detailing
Product type
T-Shirt
Vendor
F&F Batch 4
SKU RASTAH-10693967282488

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 150

Currently unavailable

View in 3DFull listing
Friends & family T-shirt (batch-01)

T-Shirt

Friends & family T-shirt (batch-01)

Introducing an exclusive offering for members of our loyalty program, "ENCLAVE" — the Friends & Family Limited Edition Black T-Shirt.

Introducing an exclusive offering for members of our loyalty program, "ENCLAVE" — the Friends & Family Limited Edition Black T-Shirt. Available only to Silver and Up Enclave members, this t-shirt embodies the spirit of camaraderie and exclusivity. Crafted from premium 100% cotton fabric with a weight of 220 GSM, it promises both comfort and quality. The back of the shirt features elegant Urdu typography that reads "Friends and Family," symbolizing the bond shared with our loyal customers. On the sleeve, you'll find the distinctive "BATCH-01" designation, marking this as the inaugural release of the Rastah Friends and Family collection. Key Features: Material: 100% cotton, 220 GSM Exclusive offering for ENCLAVE loyalty program members "Friends and Family" Urdu typography on the back "BATCH-01" sleeve detail Oversized fit for maximum comfort Care Instructions: Machine wash cold Wash inside out Gentle cycle with like colors Do not bleach Tumble dry low Iron on low heat if needed Do not dry clean Availability Launching for purchase on April 14th Shipping begins April 25th

  • Material: 100% cotton, 220 GSM
  • Exclusive offering for ENCLAVE loyalty program members
  • "Friends and Family" Urdu typography on the back
  • "BATCH-01" sleeve detail
  • Oversized fit for maximum comfort
  • Machine wash cold
  • Wash inside out
  • Gentle cycle with like colors
  • Do not bleach
  • Tumble dry low
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
F&F BATCH 1
SKU FRIENDS&FAMILYT-SHIRT(BATCH-01)-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
Friends and family T-shirt (batch-02)

T-Shirt

Friends and family T-shirt (batch-02)

Introducing an exclusive offering available for purchase on invitation only — the Friends & Family Limited Edition Beige T-Shirt.

Introducing an exclusive offering available for purchase on invitation only — the Friends & Family Limited Edition Beige T-Shirt. This t-shirt embodies the spirit of camaraderie and exclusivity. Crafted from premium 100% cotton fabric with a weight of 220 GSM, it promises both comfort and quality. The back of the shirt features elegant Urdu typography that reads "Friends and Family," symbolizing the bond shared with our loyal customers. On the sleeve, you'll find the distinctive "BATCH-02" designation, marking this as the inaugural release of the Rastah Friends and Family collection. Key Features: Material: 100% cotton, 220 GSM "Friends and Family" Urdu typography on the back "BATCH-02" sleeve detail Oversized fit for maximum comfort Care Instructions: Machine wash cold Wash inside out Gentle cycle with like colors Do not bleach Tumble dry low Iron on low heat if needed Do not dry clean

  • Material: 100% cotton, 220 GSM
  • "Friends and Family" Urdu typography on the back
  • "BATCH-02" sleeve detail
  • Oversized fit for maximum comfort
  • Machine wash cold
  • Wash inside out
  • Gentle cycle with like colors
  • Do not bleach
  • Tumble dry low
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
F&F BATCH 2
SKU FRIENDSANDFAMILYTSHIRT(BATCH-02)-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
Gathered Threads T-Shirt

T-Shirt

Gathered Threads T-Shirt

Threads get gathered before they become fabric.

Threads get gathered before they become fabric. This is the step before the loom — the act of collection, of bringing together what will be transformed. Gathered Threads T-Shirt exists at that moment: a black tee that carries RASTAH spelled out in multi-head embroidery, each letter a world of its own. On a black jersey base, the front logo is worked in multi-head machine embroidery — but this is not a standard logo placement. The artwork is worked into each individual letter, so the name becomes a composition: the letters of RASTAH as containers for imagery, for motifs, for the visual language of the collection compressed into six characters. The density of thread and the intricacy of the work-within-the-work is visible at close range. Black is the right backdrop for this kind of embroidery — it provides maximum contrast for the thread colours, maximum legibility for the detail embedded in each letter. The simplicity of the base makes the logo the entire statement. There is nothing competing with it. Threads gathered become cloth. Cloth becomes a garment. A garment becomes a statement. This shirt traces that whole sequence in a single object, concentrating it all into the six letters at the front. Key Features Black jersey construction Multi-head machine-embroidered RASTAH logo at front Detailed artwork worked within each embroidered letter Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Black jersey construction
  • Multi-head machine-embroidered RASTAH logo at front
  • Detailed artwork worked within each embroidered letter
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
SKU GATHEREDTHREADST-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 115

In stock · ready to checkout

View in 3DBuy nowFull listing
Grape wine T-shirt

T-Shirt

Grape wine T-shirt

The Grape Wine T-Shirt is a refined everyday essential crafted with thoughtful detailing.

The Grape Wine T-Shirt is a refined everyday essential crafted with thoughtful detailing. Featuring a bold back screen print, this piece is balanced by subtle accents — a branded patch at the back hem and block print detailing on the sleeve hem. Designed in a rich grape wine tone, it blends graphic expression with understated wearability, making it easy to style on its own or layered. Key Features Soft, breathable cotton fabric Back screen-printed graphic Branded patch detail on back hem Block print detailing on sleeve hem Rich grape wine colourway Relaxed fit for everyday comfort Crew neckline with reinforced stitching Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Soft, breathable cotton fabric
  • Back screen-printed graphic
  • Branded patch detail on back hem
  • Block print detailing on sleeve hem
  • Rich grape wine colourway
  • Relaxed fit for everyday comfort
  • Crew neckline with reinforced stitching
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
SS’26
SKU GRAPEWINET-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 66

Currently unavailable

View in 3DFull listing
Green mirage T-shirt

T-Shirt

Green mirage T-shirt

Rooted in the spirit of nostalgia and quiet strength, this forest green t-shirt evokes a vintage soul through traditional Mukesh hand embellishments and subtle block-printed accents.

Rooted in the spirit of nostalgia and quiet strength, this forest green t-shirt evokes a vintage soul through traditional Mukesh hand embellishments and subtle block-printed accents. Washed for a worn-in feel, it’s a gentle tribute to forgotten summers and poetic resilience — a nod to “Safar-e-Del.” Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features 100% terry cotton, sandwashed for softness Hand-embellished with traditional Mukesh work Delicate block print motifs across the garment Oversized fit for casual comfort Signature embroidered artwork on the front Care Instructions Dry clean only

  • 100% terry cotton, sandwashed for softness
  • Hand-embellished with traditional Mukesh work
  • Delicate block print motifs across the garment
  • Oversized fit for casual comfort
  • Signature embroidered artwork on the front
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU GREENMIRAGET-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 220

Currently unavailable

View in 3DFull listing
Green patchwork T-shirt

T-Shirt

Green patchwork T-shirt

This green tee is a poetic collage of South Asian heritage and modern minimalism.

This green tee is a poetic collage of South Asian heritage and modern minimalism. Featuring a hand-embroidered front logo and a tapestry of jacquard, block-printed, and textured fabrics patched at the back, it celebrates the craft of storytelling through thread. A signature Rastah label adds identity to the composition, while the soft cotton fabric ensures comfort with every wear. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: 100% cotton green t-shirt Hand-embroidered Rastah logo on front patch Back features assorted jacquard, block-printed, and hand-textured fabric patches Raw edges for a handcrafted feel Relaxed fit for all-day ease Care Instructions: Dry clean only

  • 100% cotton green t-shirt
  • Hand-embroidered Rastah logo on front patch
  • Back features assorted jacquard, block-printed, and hand-textured fabric patches
  • Raw edges for a handcrafted feel
  • Relaxed fit for all-day ease
  • Dry clean only
Product type
T-Shirt
Vendor
Songs of the Desert
SKU GREENPATCHWORKT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
Grey postcard T-shirt

T-Shirt

Grey postcard T-shirt

A classic screen-printed t-shirt crafted for everyday wear.

A classic screen-printed t-shirt crafted for everyday wear. Made from 100% cotton terry , this piece offers a soft, structured feel with added comfort. It features a clean front with a minimal chest graphic and a bold postcard-inspired artwork at the back. The relaxed silhouette and breathable fabric make it an easy essential — comfortable on its own or layered into your daily rotation. Key Features 100% cotton terry fabric Soft looped interior for added comfort Screen-printed graphics on front and back Breathable yet slightly structured hand feel Relaxed fit for everyday wear Durable print suitable for regular use Crew neckline with reinforced stitching Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton terry fabric
  • Soft looped interior for added comfort
  • Screen-printed graphics on front and back
  • Breathable yet slightly structured hand feel
  • Relaxed fit for everyday wear
  • Durable print suitable for regular use
  • Crew neckline with reinforced stitching
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
SS’26
SKU GREYPOSTCARDT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 66

In stock · ready to checkout

View in 3DBuy nowFull listing
Hand blockprint motif T-shirt

T-Shirt

Hand blockprint motif T-shirt

This piece, in the same oversized design, comes with a unique touch.

This piece, in the same oversized design, comes with a unique touch. It showcases intricate block printed motifs throughout, handcrafted by Rastah's partner artisans. The front is adorned by the Rastah logo, creating an intriguing piece of wearable art. Key Features: Oversized black T-shirt Block printed motifs handcrafted by artisans Rastah logo on the front Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Oversized black T-shirt
  • Block printed motifs handcrafted by artisans
  • Rastah logo on the front
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU HANDBLOCKPRINTMOTIFTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
Hand crafted unisex black Mughal emperor T-shirt (cropped fit)

T-Shirt

Hand crafted unisex black Mughal emperor T-shirt (cropped fit)

Charcoal Black Terry T-shirt x Mughal Art Motif INTERMISSION I FEMALE MODEL: HEIGHT: 5ft 5inches WEIGH: 105lbs SIZE: SMALL MALE MODEL: HEIGHT: 6ft 1inches WEIGH

Charcoal Black Terry T-shirt x Mughal Art Motif INTERMISSION I FEMALE MODEL: HEIGHT: 5ft 5inches WEIGH: 105lbs SIZE: SMALL MALE MODEL: HEIGHT: 6ft 1inches WEIGHT: 150lbs SIZE: LARGE FIT AND DETAILING GUIDE: Fits slightly oversized on the torso and arms, but slightly cropped in length. Shoulders are dropped, arm holes oversized, and body length cropped, giving it an effortlessly edgy and bespoke look that is perfect for the summer time. The collar, front body hem and middle back are ribbed, providing the garment with intricate and sophisticated texture dynamics. The chosen fabric for the garment is a premium terry cloth blend which was made specially for Rastah. The fabric for the motif and side-patch is hand loomed "Khaadi" fabric. The side patch is slightly distressed and front motif is finished with a grainy look. The garment is hand-crafted in the city of Lahore, Pakistan. FURTHER INFO: A limited edition hand crafted t-shirt exclusively for our close community. If you are reading this right now then we consider you a pivotal part of our journey (RASTAH) and invite you to get your hands on one of our exclusive pieces made just for you. The front motif design is printed on a hand loomed sheet of Khaddar fabric. Khadi or khaddar is a hand-spun, hand-woven natural fiber cloth from Pakistan, India, and Bangladesh mainly made out of cotton. There is a quite evident production constraint with this fabric as a single loom can only conjure up 5-7 meters of this delicate fabric in a day. Moreover, this process requires tremendous skill, expertise, and experience. It is truly a dying art form especially with the advent of modern day mass production facilities, however the quality produced through this hand-spun process cannot be compared to what is produced in giant facilities. The front motif is a Mughal inspired artwork and is finished off by an added textured grain. The patch you see on the right sleeve is made out of a distressed piece of hand loomed fabric and it features a bit of urdu poetry by the last Mughal emperor, Bahadur Shah Zafar. He was also known as a renowned poet but most of his compositions were lost. This is one of the poems that was salvaged and it reads: " Never was it as difficult to talk as it is now, never was your company as it is now Who has taken away your peace, and.... O my heart you were never so ........ as you are now " This is truly a piece that takes you back and celebrates the elements that cultivated modern day south asian culture, tradition, and art. Material and Care 260 GSM Cut & Sew Premium Terry Cotton Blend Machine wash cold Low iron on reverse side Do not dry clean

  • 260 GSM Cut & Sew
  • Premium Terry Cotton Blend
  • Machine wash cold
  • Low iron on reverse side
  • Do not dry clean
Product type
T-Shirt
Vendor
INTERMISSION I
SKU HANDCRAFTEDUNISEXBLACKMUGHALEMPERORT-SHIRT(CROPPEDFIT)-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
Heavy weight rust orange pop-art T-shirt

T-Shirt

Heavy weight rust orange pop-art T-shirt

This lightweight terry fabric shirt features an innovate raw edge collar and exclusively commissioned artwork by Pakistani artist, Digink.

This lightweight terry fabric shirt features an innovate raw edge collar and exclusively commissioned artwork by Pakistani artist, Digink. The illustration is printed on handwoven khaadi fabric. Rust Orange “Rastah” Urdu logo embroidered across the centre 80/20 Cotton:Polyester ratio Slightly oversized silhouette 280 GSM Terry Dropped shoulders Artwork printed on hand woven cotton fabric which is stitched on the back panel with raw edges Washing/Handling: Hand wash with cold water inside out & hang to dry. Male Model: 6'2; Wearing Large | Female Model: 5'10; Wearing Medium

  • Rust Orange
  • “Rastah” Urdu logo embroidered across the centre
  • 80/20 Cotton:Polyester ratio
  • Slightly oversized silhouette
  • 280 GSM Terry
  • Dropped shoulders
  • Artwork printed on hand woven cotton fabric which is stitched on the back panel with raw edges
  • Washing/Handling: Hand wash with cold water inside out & hang to dry.
  • Male Model: 6'2; Wearing Large | Female Model: 5'10; Wearing Medium
Product type
T-Shirt
Vendor
Volume II: REBIRTH
SKU HEAVYWEIGHTRUSTORANGEPOP-ARTT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Heavy weight sea green pop-art T-shirt

T-Shirt

Heavy weight sea green pop-art T-shirt

This lightweight terry fabric shirt features an innovate raw edge collar and exclusively commissioned artwork by Pakistani artist, Digink.

This lightweight terry fabric shirt features an innovate raw edge collar and exclusively commissioned artwork by Pakistani artist, Digink. The lady featured in the image is Aram Jan Begum, wife of Sultan Muhammad, a prince of the Mughal Empire. The illustration is printed on handwoven khaadi fabric. Sea Green “Rastah” Urdu logo embroidered across the centre 80/20 Cotton:Polyester ratio Slightly oversized silhouette 280 GSM Terry Dropped shoulders Artwork printed on hand woven cotton fabric which is stitched on back panel with raw edges Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6'2; Wearing Large | Female Model: 5'10; Wearing Medium

  • Sea Green
  • “Rastah” Urdu logo embroidered across the centre
  • 80/20 Cotton:Polyester ratio
  • Slightly oversized silhouette
  • 280 GSM Terry
  • Dropped shoulders
  • Artwork printed on hand woven cotton fabric which is stitched on back panel with raw edges
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6'2; Wearing Large | Female Model: 5'10; Wearing Medium
Product type
T-Shirt
Vendor
Volume II: REBIRTH
SKU HEAVYWEIGHTSEAGREENPOP-ARTT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Heritage Block Print Tee

T-Shirt

Heritage Block Print Tee

Rooted in football culture and traditional craftsmanship, the Football Base Crimson Heritage T-Shirt blends contemporary sportswear with handcrafted design elements.

Rooted in football culture and traditional craftsmanship, the Football Base Crimson Heritage T-Shirt blends contemporary sportswear with handcrafted design elements. Made from premium 100% cotton terry , this oversized T-shirt delivers superior comfort, breathability, and durability. Finished with authentic block-printed artwork and signature Rastah detailing, it offers a bold statement while celebrating football heritage through modern streetwear. Key Features Premium 100% Cotton Terry Soft and breathable heavyweight fabric Oversized relaxed fit Ribbed crew neckline Traditional block-printed artwork Front graphic detailing Premium handcrafted aesthetic Signature Rastah branding Durable everyday construction Soft-touch finish Football-inspired heritage design Built for all-day comfort Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium 100% Cotton Terry
  • Soft and breathable heavyweight fabric
  • Oversized relaxed fit
  • Ribbed crew neckline
  • Traditional block-printed artwork
  • Front graphic detailing
  • Premium handcrafted aesthetic
  • Signature Rastah branding
  • Durable everyday construction
  • Soft-touch finish
  • Football-inspired heritage design
  • Built for all-day comfort
Product type
T-Shirt
Vendor
NYC Match Day Pop-Up
SKU PORTUGALTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 185

Currently unavailable

View in 3DFull listing
Heritage Marks T-Shirt

T-Shirt

Heritage Marks T-Shirt

Heritage marks are the ones that survive — the symbols pressed into clay before it hardened, the motifs carved into stone doorways, the patterns woven into fabric as a form of record-keeping.

Heritage marks are the ones that survive — the symbols pressed into clay before it hardened, the motifs carved into stone doorways, the patterns woven into fabric as a form of record-keeping. The Heritage Marks T-Shirt assembles several of those marks onto a single surface, treating the shirt body as an archive. On a brown jersey base, front and back jute sublimation patches carry their own visual language — sublimation on jute produces a particular quality of image, slightly textured, slightly raw, different from print on smooth fabric. Screen-printed back artwork adds a larger-scale composition. Block-printed khaddar patches are laser-cut into traditional forms and applied across the body — the laser cut producing a precision of edge that distinguishes them from hand-torn or hand-cut alternatives. A hand-embroidered RASTAH logo completes the piece at the chest. Brown is the colour of the archive — of old paper, of worn leather, of the earth that archaeological sites are excavated from. Against it, the khaddar patches and jute sublimations read as fragments recovered, as pieces of something larger that the shirt reassembles. The hand embroidery on the logo marks the piece as current, as alive, as something being made now rather than unearthed. Heritage marks are worth carrying. This shirt carries several of them at once, without apology, without explanation. Key Features Brown jersey construction Jute sublimation patches front and back Screen-printed back artwork Block-printed khaddar patches laser-cut into traditional forms Hand-embroidered RASTAH logo at chest Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Brown jersey construction
  • Jute sublimation patches front and back
  • Screen-printed back artwork
  • Block-printed khaddar patches laser-cut into traditional forms
  • Hand-embroidered RASTAH logo at chest
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
SKU HERITAGEMARKST-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 123

Currently unavailable

View in 3DFull listing
Hunza Embroidered T-shirt

T-Shirt

Hunza Embroidered T-shirt

Inspired by the breathtaking landscapes of northern Pakistan, the Hunza Embroidered T-Shirt is crafted from premium jersey fabric for exceptional comfort and everyday wear.

Inspired by the breathtaking landscapes of northern Pakistan, the Hunza Embroidered T-Shirt is crafted from premium jersey fabric for exceptional comfort and everyday wear. Featuring a finely embroidered Hunza mountain design, this piece blends minimalist aesthetics with cultural inspiration. Its soft, breathable construction and relaxed fit make it an effortless everyday essential. Features Premium jersey fabric Soft, breathable, and lightweight Signature Hunza mountain embroidery Classic crew neckline Relaxed everyday fit Durable ribbed neckline Minimalist design with premium detailing Suitable for everyday casual wear Care Guide Machine wash cold with similar colors Wash inside out Do not bleach Tumble dry low or line dry Warm iron if needed (avoid embroidery) Do not iron directly on the embroidered design Do not dry clean

  • Premium jersey fabric
  • Soft, breathable, and lightweight
  • Signature Hunza mountain embroidery
  • Classic crew neckline
  • Relaxed everyday fit
  • Durable ribbed neckline
  • Minimalist design with premium detailing
  • Suitable for everyday casual wear
  • Machine wash cold with similar colors
  • Wash inside out
  • Do not bleach
  • Tumble dry low or line dry
Product type
T-Shirt
Vendor
CORE V6
SKU HUNZAEMBROIDEREDT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 106

In stock · ready to checkout

View in 3DBuy nowFull listing
Indigo dye and block print shirt

T-Shirt

Indigo dye and block print shirt

Embracing the essence of Sindhi craftsmanship, this shirt is a celebration of intricate skill and deep-rooted tradition.

Embracing the essence of Sindhi craftsmanship, this shirt is a celebration of intricate skill and deep-rooted tradition. Dyed using natural indigo in the interiors of Sindh, its hues carry the rich history and essence of the region. Expertly block printed by a renowned Sindhi artisanal family, each motif narrates a unique story. This 100% cotton fabric has been curated through a meticulous three-step process, which incorporates natural dyes and sustainable techniques, marking each piece as a testament to the unparalleled beauty of slow fashion. Technical Specifications: Fabric: 100% Cotton, Naturally Indigo Dyed and Block Printed. Features: Relaxed fit, sustainable, and naturally dyed. Model Specifications: Male: Height - 5'10, Weight - 150 lbs, Wearing Size - Medium. Female: Height - 5'5, Weight - 110 lbs, Wearing Size - Small. Washing Instructions: Hand wash with cold water. Use mild detergent. Dry in shade. Products will be launched on 21st September and shipped out on 1st October.

  • Fabric: 100% Cotton, Naturally Indigo Dyed and Block Printed.
  • Features: Relaxed fit, sustainable, and naturally dyed.
  • Male: Height - 5'10, Weight - 150 lbs, Wearing Size - Medium.
  • Female: Height - 5'5, Weight - 110 lbs, Wearing Size - Small.
  • Hand wash with cold water. Use mild detergent. Dry in shade.
Product type
T-Shirt
Vendor
VOLUME X
SKU INDIGODYEANDBLOCKPRINTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 220

Currently unavailable

View in 3DFull listing
Inner scribbles T-shirt

T-Shirt

Inner scribbles T-shirt

rafted from 100% cotton terry with a 220 GSM construction , this black t-shirt blends comfort with expressive visual storytelling.

rafted from 100% cotton terry with a 220 GSM construction , this black t-shirt blends comfort with expressive visual storytelling. The soft terry fabric provides a breathable yet structured feel, creating a relaxed silhouette suited for everyday wear. The front features a combination of screen-printed artwork and an embroidered Rastah logo , adding texture and depth to the design. A silk sublimation patch near the hem introduces a crafted textile detail that complements the visual composition. On the back, a vibrant composition of puff and screen-printed artwork unfolds through layered lines, abstract symbols, and expressive forms. The sketch-like graphic language reflects scattered thoughts and creative energy, turning the garment into a canvas that captures the chaos and beauty of the mind. Key Features 100% cotton terry fabric 220 GSM construction Black colorway Embroidered Rastah logo on front Screen-printed artwork on front Puff and screen printed artwork on back Silk sublimation patch near hem Relaxed t-shirt silhouette Ribbed crew neckline Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton terry fabric
  • 220 GSM construction
  • Black colorway
  • Embroidered Rastah logo on front
  • Screen-printed artwork on front
  • Puff and screen printed artwork on back
  • Silk sublimation patch near hem
  • Relaxed t-shirt silhouette
  • Ribbed crew neckline
Product type
T-Shirt
Vendor
volume 15
SKU INNERSCRIBBLEST-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
Justaju sea green T-shirt

T-Shirt

Justaju sea green T-shirt

The t shirt is an ode to the entirety of female athletes in the country that continue to inspire us endlessly with their determination to break through societal norms and pressures levied against women in Pakistan.

The t shirt is an ode to the entirety of female athletes in the country that continue to inspire us endlessly with their determination to break through societal norms and pressures levied against women in Pakistan. The urdu text printed is a well known verse from a song by one of Pakistan's most decorated bands - "Junoon" , and the text reads - "Justaju joh karey woh chuey aasman". In English the text translates to "Whoever perseveres shall reach the stars". A very limited number of pieces in this design have been made. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah INTERMISSION IV monogram screen printed on front hand screen printed artwork on the back Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah INTERMISSION IV monogram screen printed on front
  • hand screen printed artwork on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
INTERMISSION 4
SKU JUSTAJUSEAGREENT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Karachi Nights T-shirt

T-Shirt

Karachi Nights T-shirt

Crafted from soft jersey fabric, the Graphic Tee is designed with a clean front and a bold back graphic for a balanced everyday look.

Crafted from soft jersey fabric, the Graphic Tee is designed with a clean front and a bold back graphic for a balanced everyday look. The relaxed silhouette offers all-day comfort while maintaining a refined, contemporary aesthetic. Features Soft jersey construction Screen-printed back design Classic crew neckline Relaxed fit Everyday essential Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Do not iron directly on print Wash with similar colors

  • Soft jersey construction
  • Screen-printed back design
  • Classic crew neckline
  • Relaxed fit
  • Everyday essential
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Do not iron directly on print
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU KARACHINIGHTST-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 106

In stock · ready to checkout

View in 3DBuy nowFull listing
Khayal patchwork T-shirt

T-Shirt

Khayal patchwork T-shirt

The Paneled Denim T-shirt is a minimal yet powerful garment, crafted from durable denim fabric and elevated with a hand-stitched logo patch on the chest.

The Paneled Denim T-shirt is a minimal yet powerful garment, crafted from durable denim fabric and elevated with a hand-stitched logo patch on the chest. The red-stitched border around the patch adds a striking, artisanal touch that reflects traditional handcraft detailing. Clean lines, structured paneling, and the rugged denim texture give it both contemporary edge and cultural depth. Perfect for layering or as a standalone piece. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features 100% cotton denim construction Paneled design for structure and durability Hand-stitched logo patch on chest with contrast red detailing Relaxed, boxy silhouette for comfort and layering Durable neckline rib for added structure Minimalist back with clean finish Care Instructions Hand wash or machine wash on cold cycle with mild detergent. Wash inside out to protect prints and colours. Do not bleach. Dry on low heat cycle or lay flat in shade.

  • 100% cotton denim construction
  • Paneled design for structure and durability
  • Hand-stitched logo patch on chest with contrast red detailing
  • Relaxed, boxy silhouette for comfort and layering
  • Durable neckline rib for added structure
  • Minimalist back with clean finish
  • Hand wash or machine wash on cold cycle with mild detergent.
  • Wash inside out to protect prints and colours.
  • Do not bleach.
  • Dry on low heat cycle or lay flat in shade.
Product type
T-Shirt
Vendor
CORE F/W-25
SKU KHAYALPATCHWORKT-SHIRT-XXL-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 88

In stock · ready to checkout

View in 3DBuy nowFull listing
Khoka acid wash T-shirt

T-Shirt

Khoka acid wash T-shirt

* ONLY AVAILABLE FROM THE 8TH OF NOVEMBER TO THE 15TH OF NOVEMBER FOR PRE ORDER.

* ONLY AVAILABLE FROM THE 8TH OF NOVEMBER TO THE 15TH OF NOVEMBER FOR PRE ORDER. THIS ITEM WILL NOT BE AVAILABLE AFTER THE PRE ORDER PERIOD ENDS* *THIS IS A PRE ORDER AND ALL ORDERS WILL START TO SHIP OUT FROM THE 30TH OF NOVEMBER - NORMAL DELIVERY TIMES WILL FOLLOW ONCE ITEMS ARE SHIPPED OUT* This acid wash t-shirt features a multi coloured hand screen printed design that is inspired by quintessential Pakistani corner stores, commonly known as "Khoka" in Urdu. The front of the design features a picture of a khoka along with text overlays that translate in english to - "Hot and cold" and "Sim top up services available" respectively in Urdu. The back of the design reads "Rastah Khoka" in a multicolour print, underneath which is printed - "Made in Pakistan". *THIS IS A LIMITED EDITION ITEM WHICH WILL NOT BE RESTOCKED ONCE SOLD OUT* Slightly oversized fit Dropped shoulders 270 GSM compact combed terry Screen Printed image and text on front and back 100% cotton Washing/Handling: Hand wash with cold water inside out & hang to dry

  • Slightly oversized fit
  • Dropped shoulders
  • 270 GSM compact combed terry
  • Screen Printed image and text on front and back
  • 100% cotton
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
KHOKA DROP
SKU KHOKAACIDWASHT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Koi khabar nai - black T-shirt

T-Shirt

Koi khabar nai - black T-shirt

This piece is a take on global warming and how it’s slowly effecting our planet and diminishing our natural resources.

This piece is a take on global warming and how it’s slowly effecting our planet and diminishing our natural resources. The text on the back read “kab kahan kesay, hum sub kho bethay” meaning “Don't know when where and how we lost everything” which represents how we try to be oblivious to what we as mankind are doing to this planet.The garment consists of various hand screen printed design elements on the front and back. slightly oversized fit 200 gsm heavyweight fleece in a cotton and polyester mix Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small *THIS COLLECTION WILL BE AVAILABLE ON THE 21st FOR SALE AND WILL BE SHIPPED ON THE 23rd*

  • slightly oversized fit
  • 200 gsm heavyweight fleece in a cotton and polyester mix
  • Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
INTERMISSION VI
SKU KOIKHABARNAI-BLACKT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 86

Currently unavailable

View in 3DFull listing
Kya karte rehte ho T-shirt

T-Shirt

Kya karte rehte ho T-shirt

A faded black oversized t-shirt featuring a vivid screen-printed artwork titled “Kya Karte Rehte Ho” on the back — an abstract explosion of yellow swirls, Urdu calligraphy, floral vines, and human silhouettes.

A faded black oversized t-shirt featuring a vivid screen-printed artwork titled “Kya Karte Rehte Ho” on the back — an abstract explosion of yellow swirls, Urdu calligraphy, floral vines, and human silhouettes. The piece merges existential reflection with expressive streetwear, channeling the tension between chaos and beauty. The front features a minimal screen-printed logo in a stitched-dot style. Crafted in 100% cotton for a soft, lived-in feel. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: 100% cotton with faded black wash Oversized fit Large multicolor screen-printed artwork on the back "Kya Karte Rehte Ho" visual narrative design Urdu script and hand-drawn illustrations Screen-printed logo on front Soft, breathable fabric Drop shoulders and wide sleeves for relaxed silhouette Care Instructions: Dry clean only

  • 100% cotton with faded black wash
  • Oversized fit
  • Large multicolor screen-printed artwork on the back
  • "Kya Karte Rehte Ho" visual narrative design
  • Urdu script and hand-drawn illustrations
  • Screen-printed logo on front
  • Soft, breathable fabric
  • Drop shoulders and wide sleeves for relaxed silhouette
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU KYAKARTEREHTEHOT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
Lahore Retro T-shirt

T-Shirt

Lahore Retro T-shirt

Crafted from soft jersey fabric, the Graphic Tee combines everyday comfort with bold visual expression.

Crafted from soft jersey fabric, the Graphic Tee combines everyday comfort with bold visual expression. The statement graphic adds character to a clean silhouette, creating a versatile staple designed for effortless wear. Features Soft jersey construction Graphic print detail Classic crew neckline Relaxed fit Everyday essential design Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Do not iron directly on print Wash with similar colors

  • Soft jersey construction
  • Graphic print detail
  • Classic crew neckline
  • Relaxed fit
  • Everyday essential design
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Do not iron directly on print
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU LAHORERETROT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 106

In stock · ready to checkout

View in 3DBuy nowFull listing
Lavender logo T-shirt

T-Shirt

Lavender logo T-shirt

Lightweight and oversized t-shirt with Rastah's monogram in black printed on the front.

Lightweight and oversized t-shirt with Rastah's monogram in black printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight pre shrunk terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 16th of August. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight pre shrunk terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
SUMMER ESSENTIALS DROP 02
SKU LAVENDERLOGOTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 60

Currently unavailable

View in 3DFull listing
Lavender made in PAK T-shirt (V2)

T-Shirt

Lavender made in PAK T-shirt (V2)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. Crafted with meticulous detail, this Lavender T-Shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back. Constructed from 220 GSM cotton terry fabric, this shirt boasts an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front "Made in Pakistan" in Urdu typography on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • "Made in Pakistan" in Urdu typography on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU LAVENDERMADEINPAKTSHIRT(V2)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Light green long sleeve logo shirt

T-Shirt

Light green long sleeve logo shirt

Lightweight and oversized long sleeve shirt with Rastah's monogram in black printed on the front.

Lightweight and oversized long sleeve shirt with Rastah's monogram in black printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight pre shrunk terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 16th of August. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight pre shrunk terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
SUMMER ESSENTIALS DROP 02
SKU LIGHTGREENLONGSLEEVELOGOSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 75

Currently unavailable

View in 3DFull listing
Lived In Blockprint T-Shirt

T-Shirt

Lived In Blockprint T-Shirt

Some clothes never feel new.

Some clothes never feel new. They feel pulled out of your mother's almari, soft from a hundred Sundays, carrying the quiet weight of time. The Lived In Blockprint T-Shirt is built on that feeling, denim and khaddar patches block-printed by hand, set against premium jersey, finished with a clean Rastah logo at the chest. A piece that looks worn-in from the first wear and gets better with every one after. Part of the Threads of Nostalgia capsule is a collection rooted in late-20th- and early-21st-century Pakistani memory. Cassette tapes, slow Sunday mornings, nani's almari, gol gappay walay ki cycle. This drop translates those moments into hand-finished streetwear, designed to live with you, not just be owned. Key Features Premium 180 GSM cotton jersey base Screen-printed Rastah logo on the chest Hand block-printed denim patches Hand block-printed hand-woven khaddar patches Oversized relaxed fit Hand-finished garment, minor irregularities are part of the craft Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium 180 GSM cotton jersey base
  • Screen-printed Rastah logo on the chest
  • Hand block-printed denim patches
  • Hand block-printed hand-woven khaddar patches
  • Oversized relaxed fit
  • Hand-finished garment, minor irregularities are part of the craft
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect the patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
Threads of Nostalgia
SKU LIVEDINBLOCKPRINTT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 141

Currently unavailable

View in 3DFull listing
Los angles T-shirt

T-Shirt

Los angles T-shirt

Los angles T-shirt

Los angles T-shirt from official Rastah storefront.

  • T-Shirt
  • Rastah
Product type
T-Shirt
Vendor
Rastah
SKU LOSANGLEST-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
Man-Goes graphic T-shirt

T-Shirt

Man-Goes graphic T-shirt

The Jersey T-Shirt — Mango Print Edition is a playful nod to nostalgia and summer.

The Jersey T-Shirt — Mango Print Edition is a playful nod to nostalgia and summer. Crafted from 100% cotton jersey, it features a minimal screen-printed Rastah logo on the front and a vivid CMYK screen print of hand-illustrated mangos on the back. The relaxed silhouette and breathable texture make it an effortless everyday essential with a touch of artistry. Key Features: 100% cotton jersey fabric CMYK screen print on back Rastah logo screen print on front Relaxed, boxy fit Soft hand-feel and breathable texture Care Instructions: Hand wash or machine wash on cold cycle with mild detergent. Wash inside out to protect prints and colours. Do not bleach. Dry on low heat cycle or lay flat in the shade.

  • 100% cotton jersey fabric
  • CMYK screen print on back
  • Rastah logo screen print on front
  • Relaxed, boxy fit
  • Soft hand-feel and breathable texture
Product type
T-Shirt
Vendor
BFCM 2025
SKU MANGOEST-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
Mark & meaning T-shirt

T-Shirt

Mark & meaning T-shirt

This graphic t-shirt is inspired by Meeraji’s poem “gunahon se nash o numa pa gaya dil,” featuring the verse “کئی راز پنہاں ہیں لیکن کھلیں گے / اگر حشر کے روز پ

This graphic t-shirt is inspired by Meeraji’s poem “gunahon se nash o numa pa gaya dil,” featuring the verse “کئی راز پنہاں ہیں لیکن کھلیں گے / اگر حشر کے روز پکڑا گیا دل” — reflecting the idea of hidden truths revealed only under pressure. The artwork draws from hand reflexology, where the heart is mapped to a sensitive point on the palm, marked here by a turquoise glowing orb beneath the middle finger. This visual parallel reinforces the poem’s suggestion that the heart’s secrets remain concealed until they are pressed into reckoning. At the top of the illustration, the phrase “raseelay jaraim ki khushbu” anchors the piece to Meeraji’s language, translating poetic introspection into a symbolic, contemporary graphic form. Artwork by Maha Farooq. Please note: Size may vary by ±0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features Screen-printed Urdu logo at front Screen-printed artwork at back and sleeve Sublimation printed fabric patch at front hem High-quality graphic placement with layered detailing Relaxed fit for everyday wear Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect print and color Do not bleach Lay flat or hang to dry in the shade

  • Screen-printed Urdu logo at front
  • Screen-printed artwork at back and sleeve
  • Sublimation printed fabric patch at front hem
  • High-quality graphic placement with layered detailing
  • Relaxed fit for everyday wear
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect print and color
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
Azad Nazm
SKU MARK&MEANINGT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
Maroon acid wash made in PAK T-shirt (V4)

T-Shirt

Maroon acid wash made in PAK T-shirt (V4)

Product Overview: Crafted from 100% premium cotton , this t-shirt features a maroon acid wash finish for a bold, vintage-inspired look.

Product Overview: Crafted from 100% premium cotton , this t-shirt features a maroon acid wash finish for a bold, vintage-inspired look. With its oversized silhouette, it delivers both comfort and contemporary streetwear vibes. Back Design: Bold puff-printed English "Rastah" logo for a standout appearance. Urdu typography underneath reads: "Designed in Rastah Studio Lahore | Made in Pakistan" . A crescent moon and star motif with "Established in 2018" pays homage to cultural heritage. Key Features: Material: 100% premium cotton for breathability and comfort. Finish: Unique acid wash effect for a rugged, vintage look. Fit: Oversized silhouette for relaxed, modern styling. Design Elements: Puff-printed logo with cultural Urdu typography. Care Instructions: Machine wash cold with like colors. Tumble dry on low heat or air dry. Iron on low heat, avoiding printed areas.

  • Bold puff-printed English "Rastah" logo for a standout appearance.
  • Urdu typography underneath reads: "Designed in Rastah Studio Lahore | Made in Pakistan" .
  • A crescent moon and star motif with "Established in 2018" pays homage to cultural heritage.
  • Material: 100% premium cotton for breathability and comfort.
  • Finish: Unique acid wash effect for a rugged, vintage look.
  • Fit: Oversized silhouette for relaxed, modern styling.
  • Design Elements: Puff-printed logo with cultural Urdu typography.
  • Machine wash cold with like colors.
  • Tumble dry on low heat or air dry.
  • Iron on low heat, avoiding printed areas.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU MAROONACIDWASHMADEINPAKT-SHIRT(V4)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Maroon beige raglan T-shirt (V5)

T-Shirt

Maroon beige raglan T-shirt (V5)

A terry cotton raglan t-shirt featuring contrast maroon sleeves and a beige body.

A terry cotton raglan t-shirt featuring contrast maroon sleeves and a beige body. Finished with a minimal screen-printed Urdu "Rastah" logo at the chest, this piece blends athletic nostalgia with contemporary streetwear edge. Key Features: Fabric: 100% terry cotton Color: Beige body with maroon contrast sleeves Fit: Relaxed raglan cut Front: Screen-printed Urdu "Rastah" logo Soft and breathable Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat (avoid print area)

  • Fabric: 100% terry cotton
  • Color: Beige body with maroon contrast sleeves
  • Fit: Relaxed raglan cut
  • Front: Screen-printed Urdu "Rastah" logo
  • Soft and breathable
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat (avoid print area)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU MAROONBEIGERAGLANT-SHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 93

In stock · ready to checkout

View in 3DBuy nowFull listing
Maroon knit cotton jersey T-shirt

T-Shirt

Maroon knit cotton jersey T-shirt

A versatile everyday essential redefined — this maroon knit cotton jersey tee features contrast ribbed neckline and sleeve edges, accented with cream piping along raglan seams and a screen-printed Urdu logo at chest.

A versatile everyday essential redefined — this maroon knit cotton jersey tee features contrast ribbed neckline and sleeve edges, accented with cream piping along raglan seams and a screen-printed Urdu logo at chest. Soft, structured, and elevated with a minimal graphic edge. Key Features: Fabric: Knit cotton jersey Color: Maroon with pink contrast trim Screen-printed Urdu logo on chest Contrast neckline, sleeve hem & shoulder piping Regular fit with raglan sleeves Care Instructions: Machine wash cold with like colors Turn inside out before washing Tumble dry low or air dry

  • Fabric: Knit cotton jersey
  • Color: Maroon with pink contrast trim
  • Screen-printed Urdu logo on chest
  • Contrast neckline, sleeve hem & shoulder piping
  • Regular fit with raglan sleeves
  • Machine wash cold with like colors
  • Turn inside out before washing
  • Tumble dry low or air dry
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU MAROONKNITCOTTONJERSEYTSHIRT-XL-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 62

In stock · ready to checkout

View in 3DBuy nowFull listing
Maroon knit jacquard polo shirt

T-Shirt

Maroon knit jacquard polo shirt

A classic silhouette meets modern craft — this maroon short-sleeve polo is knit in jacquard with an abstract pixelated pattern throughout.

A classic silhouette meets modern craft — this maroon short-sleeve polo is knit in jacquard with an abstract pixelated pattern throughout. Featuring a three-button placket, pointed collar, and structured fit, it’s a refined nod to vintage sportswear with contemporary detail. Key Features: Fabric: Knit jacquard Color: Maroon base with light patterned detailing Three-button polo placket Pointed collar Fitted cropped length Care Instructions: Hand wash cold or gentle machine wash Use mild detergent Lay flat to dry Do not wring or bleach Iron on low if needed, inside out

  • Fabric: Knit jacquard
  • Color: Maroon base with light patterned detailing
  • Three-button polo placket
  • Pointed collar
  • Fitted cropped length
  • Hand wash cold or gentle machine wash
  • Use mild detergent
  • Lay flat to dry
  • Do not wring or bleach
  • Iron on low if needed, inside out
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU MAROONKNITJACQUARDPOLOSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 198

In stock · ready to checkout

View in 3DBuy nowFull listing
Maroon logo pullover

T-Shirt

Maroon logo pullover

An oversized heavyweight pullover with pleated sleeves and ribbed cuffs and hems featuring our Urdu script logo that translates to "path" or "journey".

An oversized heavyweight pullover with pleated sleeves and ribbed cuffs and hems featuring our Urdu script logo that translates to "path" or "journey". 300 gsm heavyweight fleece Maroon colour 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in accrue colour Pleated sleeves Ribbed cuffs, hems and collar Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.

  • 300 gsm heavyweight fleece
  • Maroon colour
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in accrue colour
  • Pleated sleeves
  • Ribbed cuffs, hems and collar
  • Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.
Product type
T-Shirt
Vendor
Intermission II
SKU MAROONLOGOPULLOVER-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Maroon sleeve patch T-shirt

T-Shirt

Maroon sleeve patch T-shirt

A maroon heavy weight t-shirt adorned by a sleeve patch showcasing the siege of Golconda in 1687 by Aurengzeb.

A maroon heavy weight t-shirt adorned by a sleeve patch showcasing the siege of Golconda in 1687 by Aurengzeb. The design is printed on hand woven khaddar fabric. The fabric was made in house and stitched on with raw edges allowing for a more gritty & worn look. 300 gsm heavyweight fleece Maroon colour 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in accrue colour Pleated sleeves Ribbed cuffs, hems and collar Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.

  • 300 gsm heavyweight fleece
  • Maroon colour
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in accrue colour
  • Pleated sleeves
  • Ribbed cuffs, hems and collar
  • Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.
Product type
T-Shirt
Vendor
Intermission II
SKU MAROONSLEEVEPATCHT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 66

Currently unavailable

View in 3DFull listing
Mehraab T-shirt

T-Shirt

Mehraab T-shirt

A mint colored t-shirt crafted from 100% cotton terry with a 220 GSM construction.

A mint colored t-shirt crafted from 100% cotton terry with a 220 GSM construction. The garment features traditional block printed artwork inspired by arch forms. The design highlights handcrafted printing techniques. A screen printed Rastah logo completes the piece. Key Features 100% cotton terry fabric 220 GSM fabric weight Block print artwork Screen printed Rastah logo Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton terry fabric
  • 220 GSM fabric weight
  • Block print artwork
  • Screen printed Rastah logo
Product type
T-Shirt
Vendor
volume 15
SKU MEHRAABT-SHIR-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
Mein T-shirt

T-Shirt

Mein T-shirt

Screen-printed T-shirt made from premium 100% cotton (220 GSM), featuring the Urdu Rastah logo at the front and expressive artwork on the front and back.

Screen-printed T-shirt made from premium 100% cotton (220 GSM), featuring the Urdu Rastah logo at the front and expressive artwork on the front and back. Designed in a relaxed silhouette, balancing comfort with artistic storytelling. A versatile statement piece for everyday wear. Artwork by Maha Farooq. Size may vary by ±0.5 inches. Colors and stitch/patch details may vary slightly due to handmade processes and display settings. Key Features: • Premium 100% cotton fabric (220 GSM) • Front Urdu Rastah logo screen print • Expressive artwork printed on front and back • Relaxed, comfortable silhouette • Soft hand feel with durable print finish • Designed for everyday wear with artistic detail Care Instructions: Hand wash or machine wash cold inside out. Do not bleach. Iron inside out on low heat. Do not tumble dry.

  • T-Shirt
  • Azad Nazm
Product type
T-Shirt
Vendor
Azad Nazm
SKU MEINT-SHIRT-XL-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Mera haal - beige T-shirt

T-Shirt

Mera haal - beige T-shirt

The piece depicts the feeling that every once in a while we all go through the feeling where everything starts building up in life and all we want is to be left alone.

The piece depicts the feeling that every once in a while we all go through the feeling where everything starts building up in life and all we want is to be left alone. This is exactly what the text on the back and front read, which is “ chor do mujey meray haal par” which translates to “leave me, the way i am”. The design has hand screen printed elements throughout. slightly oversized fit 200 gsm heavyweight fleece in a cotton and polyester mix Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small *THIS COLLECTION WILL BE AVAILABLE ON THE 21st FOR SALE AND WILL BE SHIPPED ON THE 23rd*

  • slightly oversized fit
  • 200 gsm heavyweight fleece in a cotton and polyester mix
  • Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
INTERMISSION VI
Compare at
PKR 86
SKU MERAHAAL-BEIGET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 86

Currently unavailable

View in 3DFull listing
Miandad inspired sixer T-shirt

T-Shirt

Miandad inspired sixer T-shirt

The t shirt is inspired by Javed Miandads iconic last ball six against India during the 1986 Austral-Asia cup.

The t shirt is inspired by Javed Miandads iconic last ball six against India during the 1986 Austral-Asia cup. Thee design is screen printed and a very limited number of pieces have been made. The front of the garment includes an embroidered rastah logo reinterpreted in form of the pakistani cricket teams logo. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah INTERMISSION IV monogram embroidered on front hand screen printed artwork on the back Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah INTERMISSION IV monogram embroidered on front
  • hand screen printed artwork on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
INTERMISSION 4
Compare at
PKR 79
SKU MIANDADINSPIREDSIXERT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Midnight Dastaan T-Shirt

T-Shirt

Midnight Dastaan T-Shirt

Dastaan means epic — the long story, the one told over multiple nights, the narrative that holds a civilization's imagination.

Dastaan means epic — the long story, the one told over multiple nights, the narrative that holds a civilization's imagination. Every epic has its midnight chapter: the part where the tone drops, where things become serious, where the most consequential events happen in the dark. The Midnight Dastaan T-Shirt is dressed for that chapter. On a purple jersey base, the shirt's front logo is hand-embellished in pearls and naqshi — naqshi being a traditional form of intricate decorative pattern, here applied to the logo in material form, making it tactile and reflective simultaneously. The back carries multi-head machine-embroidered artwork, a composition of considerable scale and density. A hand-drawn jute sublimation patch sits on the body, the slowest element on the shirt, made one at a time. Purple at midnight is not mysterious for its own sake — it is the colour of the stories that matter, of the late hours when things get said that can't be taken back. The pearls and naqshi on the logo give the front of the shirt a jewelled quality that is unusual on a jersey tee, pushing it into a register between casual and ceremonial. The embroidered back brings the visual weight that the front's restraint earns. Every dastaan needs a midnight. This shirt is dressed for it, built for it, named for it. Key Features Purple jersey construction Hand-embellished logo in pearls and naqshi at front Multi-head machine-embroidered back artwork Hand-drawn jute sublimation patch Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Purple jersey construction
  • Hand-embellished logo in pearls and naqshi at front
  • Multi-head machine-embroidered back artwork
  • Hand-drawn jute sublimation patch
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
SKU MIDNIGHTDASTAANT-SHIRT-M-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 115

In stock · ready to checkout

View in 3DBuy nowFull listing
Minimal pink logo T-shirt

T-Shirt

Minimal pink logo T-shirt

This lightweight terry fabric shirt features our classic Urdu script logo that translates to "path" or "journey".

This lightweight terry fabric shirt features our classic Urdu script logo that translates to "path" or "journey". 300 gsm heavyweight fleece Brick pink colour Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in accrue colour Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.

  • 300 gsm heavyweight fleece
  • Brick pink colour
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in accrue colour
  • Male model is 5’10 and wearing a medium, female model is 5’6 and wearing a small.
Product type
T-Shirt
Vendor
Intermission II
SKU MINIMALPINKLOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 49

Currently unavailable

View in 3DFull listing
Minimalist black T-shirt

T-Shirt

Minimalist black T-shirt

This lightweight terry fabric shirt features our classic monogrom logo and a ribbed collar.

This lightweight terry fabric shirt features our classic monogrom logo and a ribbed collar. Black “Rastah” Urdu logo embroidered across the centre 80/20 cotton poly ratio Slightly oversized silhouette 280 gsm Dropped shoulders Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6'2; Wearing Large | Female Model: 5'10; Wearing Medium

  • Black
  • “Rastah” Urdu logo embroidered across the centre
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • 280 gsm
  • Dropped shoulders
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6'2; Wearing Large | Female Model: 5'10; Wearing Medium
Product type
T-Shirt
Vendor
Volume II: REBIRTH
SKU MINIMALISTBLACKT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 49

Currently unavailable

View in 3DFull listing
Model town off white T-shirt

T-Shirt

Model town off white T-shirt

Lightweight and oversized t shirt with Rastah's Volume V monogram printed on the front.

Lightweight and oversized t shirt with Rastah's Volume V monogram printed on the front. The back of the garment includes a map of one of Lahore's oldest neighbourhoods - Model Town. The patch is printed on handwoven slub khaddar fabric that was woven by Rastah's in house weaving team in the city of Kasur. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah Volume V monogram screen printed on front Model Town patch on back Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 6ft ; wearing: Medium | Female Model: 5'7; Wearing small

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah Volume V monogram screen printed on front
  • Model Town patch on back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 6ft ; wearing: Medium | Female Model: 5'7; Wearing small
Product type
T-Shirt
Vendor
VOLUME V
SKU MODELTOWNOFFWHITET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 71

Currently unavailable

View in 3DFull listing
Moss green made in PAK T-shirt (V1)

T-Shirt

Moss green made in PAK T-shirt (V1)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. The moss green Rastah Logo T-Shirt subtly exhibits the brand's identity, featuring the Rastah logo puff printed in Urdu on the front and the English logo alongside "Made in Pakistan" on the back. Crafted from 220 GSM cotton terry fabric. The fabric for the piece is custom made for Rastah and its specifications. Key Features: Urdu Rastah logo on the front English Rastah logo and "Made in Pakistan" on the back 220 GSM 100% compact combed cotton Garment dyed Oversized fit Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Washing Instructions: Wash in cold water inside out and hang to dry or dry on a low heat cycle in the dryer. *Please note the colour of this product may slightly vary due to studio lighting and your screens resolution*

  • Urdu Rastah logo on the front
  • English Rastah logo and "Made in Pakistan" on the back
  • 220 GSM 100% compact combed cotton
  • Garment dyed
  • Oversized fit
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
RESTOCK
SKU MOSSGREENMADEINPAKTSHIRT(V1)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Moss green made in PAK T-shirt (V2)

T-Shirt

Moss green made in PAK T-shirt (V2)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. Crafted with meticulous detail, this Green T-Shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back. Constructed from 220 GSM cotton terry fabric, this shirt boasts an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front "Made in Pakistan" in Urdu typography on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • "Made in Pakistan" in Urdu typography on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU MOSSGREENMADEINPAKTSHIRT(V2)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Mosswood made in PAK T-shirt (V2)

T-Shirt

Mosswood made in PAK T-shirt (V2)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. Crafted with meticulous detail, this T-shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back. Constructed from 220 GSM cotton terry fabric, this shirt boasts an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front "Made in Pakistan" in Urdu typography on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • "Made in Pakistan" in Urdu typography on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU MOSSWOODMADEINPAKT-SHIRT(V2)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Naqsh Patchwork T-shirt

T-Shirt

Naqsh Patchwork T-shirt

Crafted from soft jersey fabric, the Graphic Tee combines everyday comfort with distinctive detailing.

Crafted from soft jersey fabric, the Graphic Tee combines everyday comfort with distinctive detailing. Features Soft jersey construction Classic crew neckline Relaxed fit Everyday essential design Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Do not iron directly on patch Wash with similar colors

  • Soft jersey construction
  • Classic crew neckline
  • Relaxed fit
  • Everyday essential design
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Do not iron directly on patch
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU NAQSHPATCHWORKT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Naqsh-E-Jadoo T-shirt

T-Shirt

Naqsh-E-Jadoo T-shirt

Infused with mysticism and symbolism, the Garden Spell T-Shirt combines hand-drawn floral motifs, butterflies, and expressive Urdu typography to create a surreal visual story.

Infused with mysticism and symbolism, the Garden Spell T-Shirt combines hand-drawn floral motifs, butterflies, and expressive Urdu typography to create a surreal visual story. Set against a black acid-wash base, the bold screen-printed artwork on the back evokes themes of transformation, enchantment, and nature's hidden magic. A soft yet structured silhouette makes it wearable art with attitude. Key Features 220 GSM 100% cotton terry Washed black base with acid-dye finish Oversized, relaxed fit Large multicolor screen print on back Urdu script details with symbolic illustration Rastah logo screen printed on chest (front) Care Instructions Dry clean only

  • 220 GSM 100% cotton terry
  • Washed black base with acid-dye finish
  • Oversized, relaxed fit
  • Large multicolor screen print on back
  • Urdu script details with symbolic illustration
  • Rastah logo screen printed on chest (front)
  • Dry clean only
Product type
T-Shirt
Vendor
UNLUCKY CHARMS
SKU NAQSH-E-JADOOTSHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 119

Currently unavailable

View in 3DFull listing
Naqsh-E-Khayal knit top

T-Shirt

Naqsh-E-Khayal knit top

The Safar-e-Del Absurdity & Awe Knit Top delves into life's profound questions.

The Safar-e-Del Absurdity & Awe Knit Top delves into life's profound questions. This premium knit jacquard top features "Rastah 1818" on the front (a nod to Fallen Angels ). The back showcases an intricate jacquard artwork, visually exploring existential angst, the beauty in absurdity, and inherent wonder . A bold V-neck with contrasting black sleeves completes this philosophical yet stylish piece. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: Premium Knit Jacquard: High-quality textured fabric. Profound Back Artwork: Intricately woven jacquard depicting existential themes. "Rastah 1818" Front: With Fallen Angels reference. Stylish Design: V-neck with contrasting black sleeves and collar. Care Instructions: Dry clean only

  • Premium Knit Jacquard: High-quality textured fabric.
  • Profound Back Artwork: Intricately woven jacquard depicting existential themes.
  • "Rastah 1818" Front: With Fallen Angels reference.
  • Stylish Design: V-neck with contrasting black sleeves and collar.
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU NAQSH-E-KHAYALKNITTOP-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
National anthem black thermal T-shirt

T-Shirt

National anthem black thermal T-shirt

An oversized black thermal fabric tee, with hand distressed, raw edges at the collar.

An oversized black thermal fabric tee, with hand distressed, raw edges at the collar. A handwoven patch on the back showcases the national anthem of Pakistan in the hand-writing of its author, renowned urdu poet Hafeez Jalandhri. Jalandhri is also credited with writing the Kashimiri Anthem and the famous Shahnama-e-Islam . He passed away in his home in Model Town, Lahore, in 1982, but his words still live on in the hearts of generations of admirers. 260 gsm heavyweight terry Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in white color Male model wearing medium 5'10 Female model wearing small 5'5

  • 260 gsm heavyweight terry
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in white color
  • Male model wearing medium 5'10
  • Female model wearing small 5'5
Product type
T-Shirt
Vendor
VOLUME III
SKU NATIONALANTHEMBLACKTHERMALTEE-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Navy blue made in PAK T-shirt (mock neck)

T-Shirt

Navy blue made in PAK T-shirt (mock neck)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. Crafted with meticulous detail, this Navy T-Shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back. Constructed from 220 GSM cotton terry fabric, this shirt boasts a mock neck collar and an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front "Made in Pakistan" in Urdu typography on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Mock neck collar Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • "Made in Pakistan" in Urdu typography on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Mock neck collar
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU NAVYBLUEMADEINPAKTSHIRT(MOCKNECK)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Navy knit jacquard crop top

T-Shirt

Navy knit jacquard crop top

A bold blend of craftsmanship and modernity, this navy knit jacquard crop top features a pixelated grid pattern throughout.

A bold blend of craftsmanship and modernity, this navy knit jacquard crop top features a pixelated grid pattern throughout. With a structured silhouette, half sleeves, and contrast embroidered logo, it’s a contemporary essential rooted in artisanal detail. Key Features: Fabric: Knit jacquard Color: Navy with cream pixel pattern Cropped boxy silhouette Half sleeves Screen-printed Urdu logo detail Soft and breathable feel Care Instructions: Hand wash cold Do not bleach Lay flat to dry Iron on low heat inside out Avoid tumble drying

  • Fabric: Knit jacquard
  • Color: Navy with cream pixel pattern
  • Cropped boxy silhouette
  • Half sleeves
  • Screen-printed Urdu logo detail
  • Soft and breathable feel
  • Hand wash cold
  • Do not bleach
  • Lay flat to dry
  • Iron on low heat inside out
  • Avoid tumble drying
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU NAVYKNITJACQUARDCROPTOP-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 198

In stock · ready to checkout

View in 3DBuy nowFull listing
Navy regular fit embroidered logo T-shirt

T-Shirt

Navy regular fit embroidered logo T-shirt

This White Jersey regular fit T-Shirt brings a fresh, vibrant look with bold navy blue rib accents on the sleeves and crew neckline.

This White Jersey regular fit T-Shirt brings a fresh, vibrant look with bold navy blue rib accents on the sleeves and crew neckline. The navy blue embroidered Rastah logo on the chest adds a touch of cultural flair. This shirt combines comfort and style, making it a perfect choice for casual and streetwear-inspired looks. Fabric Details Material : Soft and breathable jersey fabric, ensuring all-day comfort. Weight : 220 GSM, providing structure while maintaining a lightweight feel. Design Features Navy Ribbed Accents : Contrasting navy ribbing on the sleeves and neckline for a pop of color. Embroidered Logo : Signature navy Rastah logo on the chest for a distinctive touch. Regular Fit : Comfortable and classic fit designed for everyday wear. Fit Fitting : Regular fit, offering a comfortable and relaxed look. Care Instructions Machine wash in cold water on a gentle cycle. Avoid bleach to preserve fabric and logo quality. Air dry to retain the fabric's softness. Use a cool iron on the reverse side if needed.

  • Material : Soft and breathable jersey fabric, ensuring all-day comfort.
  • Weight : 220 GSM, providing structure while maintaining a lightweight feel.
  • Navy Ribbed Accents : Contrasting navy ribbing on the sleeves and neckline for a pop of color.
  • Embroidered Logo : Signature navy Rastah logo on the chest for a distinctive touch.
  • Regular Fit : Comfortable and classic fit designed for everyday wear.
  • Fitting : Regular fit, offering a comfortable and relaxed look.
  • Machine wash in cold water on a gentle cycle.
  • Avoid bleach to preserve fabric and logo quality.
  • Air dry to retain the fabric's softness.
  • Use a cool iron on the reverse side if needed.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU NAVYREGULARFITEMBROIDEREDLOGOTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Night vigil women’s top

T-Shirt

Night vigil women’s top

A sleeveless, body-fitted top crafted from washed denim with all-over single-color block printing.

A sleeveless, body-fitted top crafted from washed denim with all-over single-color block printing. Designed with a Mughal-inspired neckline and godet panels at the hem, the silhouette offers structure, movement, and a refined handcrafted finish. Key Features Sleeveless women’s top in washed denim Mughal-inspired neckline All-over single-color block printing Body-fitted silhouette Godet panels at hem for added flare Fully lined for structure and comfort Front zip closure Handcrafted finish with subtle variations Care Instructions Dry clean only

  • Sleeveless women’s top in washed denim
  • Mughal-inspired neckline
  • All-over single-color block printing
  • Body-fitted silhouette
  • Godet panels at hem for added flare
  • Fully lined for structure and comfort
  • Front zip closure
  • Handcrafted finish with subtle variations
Product type
T-Shirt
Vendor
TUTINAMA
SKU RASTAH-10388867121464

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 395

Currently unavailable

View in 3DFull listing
Notes From The North T-Shirt

T-Shirt

Notes From The North T-Shirt

The north has always sent messages south — through trade routes, through music, through the people who carry both with them.

The north has always sent messages south — through trade routes, through music, through the people who carry both with them. Notes From The North is RASTAH's letter from those mountains: a tee that translates northern craft traditions into a language that moves through cities. Built on a black jersey base, the shirt leads with a multi-head machine-embroidered front logo — each letter given depth and texture through layered thread passes. The back carries an embroidered artwork composition that references northern textile traditions in its pattern structure. Jute sublimation patches at the back add a third material register, a rougher surface that grounds the embroidery above it. Black provides the silence that lets the embroidery speak. Multi-head embroidery at scale is rare on ready-to-wear — it carries the speed and precision of machine work with a thread density that reads almost tactile when you see it in person. The jute patches introduce an earthy material contrast that pulls the shirt toward the craft landscape it references. These are the notes that travel furthest: the ones stitched into cloth, carried across generations, and worn by people who know what they're carrying. Key Features Black jersey construction Multi-head machine-embroidered front RASTAH logo Embroidered back artwork Jute sublimation patches at back Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Black jersey construction
  • Multi-head machine-embroidered front RASTAH logo
  • Embroidered back artwork
  • Jute sublimation patches at back
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
SKU NOTESFROMTHENORTHT-SHIRT-M-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 115

In stock · ready to checkout

View in 3DBuy nowFull listing
Olive green made in PAK T-shirt (V5)

T-Shirt

Olive green made in PAK T-shirt (V5)

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a olive green tone.

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a olive green tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton terry Color: Olive Green Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton terry
  • Color: Olive Green
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
RESTOCK
Compare at
PKR 93
SKU OLIVEGREENMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 83

In stock · ready to checkout

View in 3DBuy nowFull listing
Open road T-shirt

T-Shirt

Open road T-shirt

Crafted from cotton terry, this t-shirt features a screen-printed RASTAH logo on the front, paired with graphic artwork and a jute sublimation patch secured with hand-applied fashion stitches.

Crafted from cotton terry, this t-shirt features a screen-printed RASTAH logo on the front, paired with graphic artwork and a jute sublimation patch secured with hand-applied fashion stitches. The back showcases a layered composition combining screen print and sublimation patchwork. Laser-cut patches add depth and texture to the overall design. The piece balances clean structure with expressive detailing. Key Features Cotton terry fabric Screen-printed RASTAH logo on front Screen-printed artwork Jute sublimation patch with hand stitching Screen print and sublimation patchwork on back Laser-cut patch detailing Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Cotton terry fabric
  • Screen-printed RASTAH logo on front
  • Screen-printed artwork
  • Jute sublimation patch with hand stitching
  • Screen print and sublimation patchwork on back
  • Laser-cut patch detailing
Product type
T-Shirt
Vendor
volume 15
SKU OPENROADT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 119

Currently unavailable

View in 3DFull listing
Orange "starry night" patch T-shirt

T-Shirt

Orange "starry night" patch T-shirt

For Volume IV, Rastah re-examines its basics and presents elevated garments with greater depth and dimension.

For Volume IV, Rastah re-examines its basics and presents elevated garments with greater depth and dimension. This orange Volume IV exclusive crew neck t-shirt was garment dyed in-house to give it added texture. The garment is hemmed at the body and sleeves. "At a distance the design may look like a typical dystopian graphic but in reality it is the story of how we often glance over things and skip all the important bits and pieces. I want people to look at the design and ponder over why i made the decisions that i did because each and every design element in this art piece carries a deeper meaning which I’ve left open to interpretation, because everyone has their own way of looking at things and that is what art should really be." - Alyan Khan Tareen on his digital art piece. Alyan's design is a unique interpretation of the often dystopian realities of truck drivers and bedford trucks in Pakistan through his unique style which amalgamates various references and elements related to truck art. The patch is uniquely placed on the upper left front side of the garment giving it an overall exaggerated appearance. *THIS IS A LIMITED EDITION ITEM WHICH WILL NOT BE RESTOCKED ONCE SOLD OUT* Slightly oversized fit Dropped shoulders 270 GSM compact combed terry “Rastah” volume IV monogram printed on front 80/20 Cotton: Polyester ratio Printed Khaddar fabric patch on front Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10; Wearing Medium | Female Model: 5'5; Wearing Small

  • Slightly oversized fit
  • Dropped shoulders
  • 270 GSM compact combed terry
  • “Rastah” volume IV monogram printed on front
  • 80/20 Cotton: Polyester ratio
  • Printed Khaddar fabric patch on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10; Wearing Medium | Female Model: 5'5; Wearing Small
Product type
T-Shirt
Vendor
VOLUME IV
SKU ORANGESTARRYNIGHTPATCHT-SHIRT-S-01

Sizes / variants: s · m · l · xl

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Orange jinnah collage T-shirt

T-Shirt

Orange jinnah collage T-shirt

Oversized rust orange terry cloth t-shirt with raw edges at the collar and a handwoven patch on the back.

Oversized rust orange terry cloth t-shirt with raw edges at the collar and a handwoven patch on the back. The patch showcases a collaborative piece with Pakistani artist Digink, and marks a continuation of the house’s collaboration with the popular digital illustrator. In this complicated and heavily referential artwork, images of Mohammad Ali Jinnah are interposed between nostalgic iconography, such as the writings and images of critically acclaimed poets, like Sadat Hasan Manto and Sadequain, and famed landmarks like the Malir hotel in Karachi. 260 gsm heavyweight terry Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in white color Male model wearing medium 5'10 Female model wearing small 5'5

  • 260 gsm heavyweight terry
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in white color
  • Male model wearing medium 5'10
  • Female model wearing small 5'5
Product type
T-Shirt
Vendor
VOLUME III
SKU ORANGEJINNAHCOLLAGET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Painter’s memory T-shirt

T-Shirt

Painter’s memory T-shirt

Crafted in soft acid-wash jersey, the t-shirt features an abstract front logo and an intricate back composition blending expressive line art, organic forms, and symbolic motifs.

Crafted in soft acid-wash jersey, the t-shirt features an abstract front logo and an intricate back composition blending expressive line art, organic forms, and symbolic motifs. The vibrant screen prints evoke an artist’s sketchbook — chaotic, poetic, and deeply human. Each element pays homage to the relationship between imagination and identity, turning a simple garment into a moving canvas. Key Features: 100% cotton acid-wash jersey Screen-printed artwork on front, back, and sleeves Soft, breathable, and durable fabric Oversized relaxed silhouette Ribbed neckline for comfort Care Instructions: Machine wash cold inside out with mild detergent. Avoid bleach and tumble dry. Dry flat in shade to preserve prints and fabric texture. Iron on low heat, avoiding printed areas.

  • 100% cotton acid-wash jersey
  • Screen-printed artwork on front, back, and sleeves
  • Soft, breathable, and durable fabric
  • Oversized relaxed silhouette
  • Ribbed neckline for comfort
Product type
T-Shirt
Vendor
BFCM 2025
SKU PAINTER’SMEMORYT-SHIRT-S-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
PAK signature stripe T-shirt

T-Shirt

PAK signature stripe T-shirt

Crafted from 220 GSM 100% cotton terry, this t-shirt blends cricket-inspired heritage with modern streetwear.

Crafted from 220 GSM 100% cotton terry, this t-shirt blends cricket-inspired heritage with modern streetwear. Featuring screen-printed patches and a signature Rastah logo, it delivers a balance of comfort, breathability, and statement design for everyday wear. Key Features: Made from 220 GSM 100% cotton terry for a soft, breathable feel Screen-printed patches with detailed artwork Relaxed fit for everyday comfort and ease of movement Signature Rastah logo patch for a distinct identity Durable construction for long-lasting wear Care Instructions: Machine wash cold, inside out, with similar colors Do not bleach Tumble dry low or hang to dry Avoid ironing directly on the screen-printed patches

  • Made from 220 GSM 100% cotton terry for a soft, breathable feel
  • Screen-printed patches with detailed artwork
  • Relaxed fit for everyday comfort and ease of movement
  • Signature Rastah logo patch for a distinct identity
  • Durable construction for long-lasting wear
  • Machine wash cold, inside out, with similar colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Avoid ironing directly on the screen-printed patches
Product type
T-Shirt
Vendor
RASTAH CRICKET CLUB
SKU PAKSIGNATURESTRIPETEE-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 132

In stock · ready to checkout

View in 3DBuy nowFull listing
Pakistan hockey winners T-shirt

T-Shirt

Pakistan hockey winners T-shirt

The hockey winners t shirt is an ode to Pakistans national sport of field hockey and its immensely successful history in the hockey world cup winning it a record number of four times.

The hockey winners t shirt is an ode to Pakistans national sport of field hockey and its immensely successful history in the hockey world cup winning it a record number of four times. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah INTERMISSION IV monogram screen printed on front hand screen printed artwork on the back and front Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah INTERMISSION IV monogram screen printed on front
  • hand screen printed artwork on the back and front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
INTERMISSION 4
Compare at
PKR 79
SKU PAKISTANHOCKEYWINNERST-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Pale iris acid wash made in PAK T-shirt (V5)

T-Shirt

Pale iris acid wash made in PAK T-shirt (V5)

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Acid wash pale iris tone.

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Acid wash pale iris tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton terry Color: Pale Iris Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton terry
  • Color: Pale Iris
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
Compare at
PKR 84
SKU PALEIRISACIDWASHMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 75

In stock · ready to checkout

View in 3DBuy nowFull listing
Pebble made in PAK T-shirt (V4)

T-Shirt

Pebble made in PAK T-shirt (V4)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. Step into effortless style with the Pebble Made in Pak T-Shirt – Version 4 . Crafted in a sophisticated pebble shade, this oversized tee seamlessly combines modern design with cultural artistry, making it an essential addition to your wardrobe. The front features a minimalist screen-printed Urdu "Rastah" logo in vibrant red, while the back celebrates identity with: A bold puff-printed English "Rastah" logo in red for a striking statement. Urdu text reading: "Designed in Rastah Studio Lahore, Made in Pakistan." A crescent moon and star symbol alongside "Established in 2018" , paying tribute to heritage and craftsmanship. Made from 220 GSM premium cotton , this tee is lightweight yet durable, ensuring breathable comfort for all-day wear. Key Features: Material : 100% premium cotton fabric (220 GSM) for breathable comfort. Front : Screen-printed Urdu "Rastah" logo in red. Back : Puff-printed English "Rastah" logo with Urdu typography and cultural details. Fit : Oversized for a contemporary and relaxed silhouette. Care Instructions: Machine wash cold with like colors. Tumble dry low or hang to dry. Iron on low, avoiding printed areas.

  • A bold puff-printed English "Rastah" logo in red for a striking statement.
  • Urdu text reading: "Designed in Rastah Studio Lahore, Made in Pakistan."
  • A crescent moon and star symbol alongside "Established in 2018" , paying tribute to heritage and craftsmanship.
  • Material : 100% premium cotton fabric (220 GSM) for breathable comfort.
  • Front : Screen-printed Urdu "Rastah" logo in red.
  • Back : Puff-printed English "Rastah" logo with Urdu typography and cultural details.
  • Fit : Oversized for a contemporary and relaxed silhouette.
  • Machine wash cold with like colors.
  • Tumble dry low or hang to dry.
  • Iron on low, avoiding printed areas.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU PEBBLEMADEINPAKT-SHIRT(V4)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Petals of time block print shirt

T-Shirt

Petals of time block print shirt

This shirt is a celebration of heritage, rooted in the artistry of handwoven khaddar and enriched with the timeless beauty of block printing.

This shirt is a celebration of heritage, rooted in the artistry of handwoven khaddar and enriched with the timeless beauty of block printing. Crafted in a light summery green tone, the piece features intricate floral block prints and a standout jacquard patch at the center back—each element reflecting generations of traditional techniques. Key Features: Made from breathable, handwoven khaddar cotton Light, airy fabric ideal for summer wear Traditional floral block print design across the shirt Back features a rich jacquard patch with heritage patterns Classic button-down silhouette Front chest patch with embroidered Urdu "راستہ" branding Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron on low heat if needed Do not dry clean

  • Made from breathable, handwoven khaddar cotton
  • Light, airy fabric ideal for summer wear
  • Traditional floral block print design across the shirt
  • Back features a rich jacquard patch with heritage patterns
  • Classic button-down silhouette
  • Front chest patch with embroidered Urdu "راستہ" branding
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on low heat if needed
  • Do not dry clean
Product type
T-Shirt
Vendor
Naqsh-e-Rooh
Compare at
PKR 220
SKU PETALSOFTIMEBLOCKPRINTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 143

Currently unavailable

View in 3DFull listing
Pine stone made in PAK T-shirt (V5)

T-Shirt

Pine stone made in PAK T-shirt (V5)

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Green tone.

Product Description: An oversized t-shirt crafted from 100% cotton terry fabric in a Green tone. Featuring a minimal screen-printed Urdu logo on the front and a bold bilingual screen print on the back, it blends cultural expression with streetwear ease. Key Features: Fabric: 100% cotton terry Color: Green Fit: Oversized Front: Screen-printed Urdu logo Back: Large "To Rastah" screen print in English and Urdu Finish: Dropped shoulders, relaxed drape Care Instructions: Machine wash cold with like colors Do not bleach Tumble dry low or hang to dry Iron inside out on low (avoid print)

  • Fabric: 100% cotton terry
  • Color: Green
  • Fit: Oversized
  • Front: Screen-printed Urdu logo
  • Back: Large "To Rastah" screen print in English and Urdu
  • Finish: Dropped shoulders, relaxed drape
  • Machine wash cold with like colors
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron inside out on low (avoid print)
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU PINESTONEMADEINPAKTSHIRT(V5)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Pink "eyes cant see" patch T-shirt

T-Shirt

Pink "eyes cant see" patch T-shirt

For Volume IV, Rastah re-examines its basics and presents elevated garments with greater depth and dimension.

For Volume IV, Rastah re-examines its basics and presents elevated garments with greater depth and dimension. This candy pink, Volume IV exclusive crew neck t-shirt was garment dyed in-house to give the faded and textured appearance. The garment is hemmed at the body and sleeves, and features artwork by lahore based artist, Inzer Mubashar. "Who are we without all the glitter and gold blinding us from the truth ? Life starts and ends with everything that sparkles, because no one likes looking at the distorted, dark and gruesome layers of society. Wrapped up in meaningless bling, are we just dead from the inside ?" - Inzer Mubashar, briefly commenting on what inspired her to create this design. *THIS IS A LIMITED EDITION ITEM WHICH WILL NOT BE RESTOCKED ONCE SOLD OUT* Slightly oversized fit Dropped shoulders 270 GSM compact combed terry “Rastah” Volume IV monogram on front 80/20 Cotton: Polyester ratio Ribbed collar Hand woven printed cotton art work oatch Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model:6ft; Wearing Medium | Female Model: 5'5; Wearing Small

  • Slightly oversized fit
  • Dropped shoulders
  • 270 GSM compact combed terry
  • “Rastah” Volume IV monogram on front
  • 80/20 Cotton: Polyester ratio
  • Ribbed collar
  • Hand woven printed cotton art work oatch
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model:6ft; Wearing Medium | Female Model: 5'5; Wearing Small
Product type
T-Shirt
Vendor
VOLUME IV
SKU PINKEYESCANTSEEPATCHT-SHIRT-S-01

Sizes / variants: s · m · l · xl

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Pistachio acid wash T-shirt

T-Shirt

Pistachio acid wash T-shirt

Crafted from soft cotton jersey, it features an acid-washed finish for a lived-in look.

Crafted from soft cotton jersey, it features an acid-washed finish for a lived-in look. The back showcases screen-printed and puff-printed graphics inspired by everyday Pakistani visuals — from truck art to typography — while the front keeps it minimal with a clean Urdu Rastah logo. The relaxed silhouette and cultural references create a blend of streetwear and heritage aesthetics. Key Features: Green acid-wash cotton jersey Screen print and puff print graphics on back Minimal Urdu Rastah logo on front Relaxed, boxy silhouette Ribbed crew neck 100% cotton Care Instructions: Hand wash or machine wash on cold cycle with mild detergent. Wash inside out to protect prints and colours. Do not bleach. Dry on low heat cycle or lay flat in the shade.

  • Green acid-wash cotton jersey
  • Screen print and puff print graphics on back
  • Minimal Urdu Rastah logo on front
  • Relaxed, boxy silhouette
  • Ribbed crew neck
  • 100% cotton
Product type
T-Shirt
Vendor
BFCM 2025
SKU GREENACIDWASHMADEINPAKT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
Pop Sai Qawaali Tak T-Shirt

T-Shirt

Pop Sai Qawaali Tak T-Shirt

From pop cassettes spinning in old car decks to qawaali nights echoing in courtyards, this piece carries the full arc of South Asian sound.

From pop cassettes spinning in old car decks to qawaali nights echoing in courtyards, this piece carries the full arc of South Asian sound. A screen-printed back graphic, Urdu text, and Rastah logo at the front, multihead embroidered patches, and a silk sublimation patch on the back. Made for those who grew up between two soundtracks and learned both by heart. Part of the Threads of Nostalgia capsule is a collection rooted in late-20th- and early-21st-century Pakistani memory. Cassette tapes, slow Sunday mornings, nani's almari, gol gappay walay ki cycle. This drop translates those moments into hand-finished streetwear, designed to live with you, not just be owned. Key Features Premium 180 GSM cotton jersey base Screen-printed graphic on the back Multihead embroidered patches Screen-printed Urdu text and Rastah logo at the front Silk sublimation patch on the back Oversized relaxed fit Hand-finished garment, minor irregularities are part of the craft Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium 180 GSM cotton jersey base
  • Screen-printed graphic on the back
  • Multihead embroidered patches
  • Screen-printed Urdu text and Rastah logo at the front
  • Silk sublimation patch on the back
  • Oversized relaxed fit
  • Hand-finished garment, minor irregularities are part of the craft
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect the patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
Threads of Nostalgia
SKU POPSAIQAWAALITAKT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 106

Currently unavailable

View in 3DFull listing
Powder blue printed T-shirt

T-Shirt

Powder blue printed T-shirt

The Powder Blue T-shirt offers a bold statement with its game-style cartoon print on the back and Rastah logo on the front.

The Powder Blue T-shirt offers a bold statement with its game-style cartoon print on the back and Rastah logo on the front. The piece dyed cotton-polyester blend adds durability to its stylish oversized fit. Urdu text on the back translates to "We read everything but never learned about ourselves, and where am I stuck." Key Features: Powder blue, oversized T-shirt Crafted from a 270 GSM 80/20 cotton-polyester mix terry fabric Rastah logo printed on the front Game-style cartoon print on the back with Urdu text, translated as "We read everything but never learned about ourselves, and where am I stuck" Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Powder blue, oversized T-shirt
  • Crafted from a 270 GSM 80/20 cotton-polyester mix terry fabric
  • Rastah logo printed on the front
  • Game-style cartoon print on the back with Urdu text, translated as "We read everything but never learned about ourselves, and where am I stuck"
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU POWDERBLUEPRINTEDTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
Powder blue printed T-shirt

T-Shirt

Powder blue printed T-shirt

The Powder Blue T-shirt offers a bold statement with its game-style cartoon print on the back and Rastah logo on the front.

The Powder Blue T-shirt offers a bold statement with its game-style cartoon print on the back and Rastah logo on the front. The piece dyed cotton-polyester blend adds durability to its stylish oversized fit. Urdu text on the back translates to "We read everything but never learned about ourselves, and where am I stuck." Key Features: Powder blue, oversized T-shirt Crafted from a 270 GSM 80/20 cotton-polyester mix terry fabric Rastah logo printed on the front Game-style cartoon print on the back with Urdu text, translated as "We read everything but never learned about ourselves, and where am I stuck" Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small Available for purchase on the 11th of June, with shipping starting on the 15th.

  • Powder blue, oversized T-shirt
  • Crafted from a 270 GSM 80/20 cotton-polyester mix terry fabric
  • Rastah logo printed on the front
  • Game-style cartoon print on the back with Urdu text, translated as "We read everything but never learned about ourselves, and where am I stuck"
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
INTERMISSION 8
SKU POWDERBLUEPRINTEDTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
Rastah cricket club T-shirt

T-Shirt

Rastah cricket club T-shirt

This paneled t-shirt, crafted from premium terry fabric, features high-definition screen-printed details with "Rastah Cricket Club" on the front.

This paneled t-shirt, crafted from premium terry fabric, features high-definition screen-printed details with "Rastah Cricket Club" on the front. A bold design blending modern aesthetics with cultural pride. Key Features: Crafted from premium 220 GSM terry fabric for a soft and breathable feel. High-definition screen-printed "Rastah Cricket Club" graphic on the front. Paneled design for a modern and bold look. Comfortable and relaxed fit for everyday wear. Unique cricket-inspired design for cultural and sporty appeal. Care Instructions: Machine wash cold, inside out, with similar colors. Do not bleach. Tumble dry low or hang to dry. Iron on reverse side at low heat, avoiding printed areas.

  • Crafted from premium 220 GSM terry fabric for a soft and breathable feel.
  • High-definition screen-printed "Rastah Cricket Club" graphic on the front.
  • Paneled design for a modern and bold look.
  • Comfortable and relaxed fit for everyday wear.
  • Unique cricket-inspired design for cultural and sporty appeal.
  • Machine wash cold, inside out, with similar colors.
  • Do not bleach.
  • Tumble dry low or hang to dry.
  • Iron on reverse side at low heat, avoiding printed areas.
Product type
T-Shirt
Vendor
RASTAH CRICKET CLUB
Compare at
PKR 101
SKU RASTAHCRICKETCLUBTEE-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 51

Currently unavailable

View in 3DFull listing
Rastah logo yacht shirt

T-Shirt

Rastah logo yacht shirt

The navy and white striped handwoven button-down shirt further explores the aesthetic potential of the dobby weave.

The navy and white striped handwoven button-down shirt further explores the aesthetic potential of the dobby weave. This variant introduces a classic striped pattern, offering a nautical and crisp visual appeal. The shirt's design includes a unique twist with raw edges along the sleeve cuffs and body hem, adding an edgy, deconstructed look that modernizes the traditional silhouette. Key Features: Crafted from handwoven fabric in a dobby weave, ensuring durability and a unique tactile experience. Navy and white striped pattern. Raw edges on the sleeve cuffs and body hem. Relaxed fit for comfort and versatility in wear. Washing Instructions: Machine wash cold with like colors to maintain the fabric's look and feel. Hang to dry or tumble dry on a low setting to preserve the raw edges. Iron on a medium setting if necessary, taking care to avoid fraying the raw edges further. Model Information: Male model: 5'11", wearing size Medium. Female model: 5'6", wearing size Small.

  • Crafted from handwoven fabric in a dobby weave, ensuring durability and a unique tactile experience.
  • Navy and white striped pattern.
  • Raw edges on the sleeve cuffs and body hem.
  • Relaxed fit for comfort and versatility in wear.
  • Machine wash cold with like colors to maintain the fabric's look and feel.
  • Hang to dry or tumble dry on a low setting to preserve the raw edges.
  • Iron on a medium setting if necessary, taking care to avoid fraying the raw edges further.
  • Male model: 5'11", wearing size Medium.
  • Female model: 5'6", wearing size Small.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU RASTAHLOGOYACHTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 189

Currently unavailable

View in 3DFull listing
Rastah-E-Rung T-shirt

T-Shirt

Rastah-E-Rung T-shirt

A fusion of structure and spontaneity, this terry t-shirt features contrasting side panels made from handwoven artisanal fabric, intricately hand-embroidered in pinks and greens.

A fusion of structure and spontaneity, this terry t-shirt features contrasting side panels made from handwoven artisanal fabric, intricately hand-embroidered in pinks and greens. The raw-edged hem and sleeves add an unfinished yet deliberate character, reflecting the imperfect beauty of handcraft. A minimalist screen-printed Rastah logo anchors the chest, allowing the side details to narrate the story of craftsmanship and heritage. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: Soft and breathable terry cotton body Side panels made from handwoven artisan fabric Traditional hand embroidery atop paneling Raw edge finishing on hem and sleeves Screen-printed Rastah logo on front chest Boxy silhouette for relaxed fit Ethically handmade in Pakistan Care Instructions: Dry clean only

  • Soft and breathable terry cotton body
  • Side panels made from handwoven artisan fabric
  • Traditional hand embroidery atop paneling
  • Raw edge finishing on hem and sleeves
  • Screen-printed Rastah logo on front chest
  • Boxy silhouette for relaxed fit
  • Ethically handmade in Pakistan
  • Dry clean only
Product type
T-Shirt
Vendor
Songs of the Desert
Compare at
PKR 132
SKU RASTAH-E-RUNGT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 86

Currently unavailable

View in 3DFull listing
Rich beige logo T-shirt

T-Shirt

Rich beige logo T-shirt

Lightweight and oversized t shirt with Rastah's monogram printed on the front.

Lightweight and oversized t shirt with Rastah's monogram printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 19th of June. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
Summer Essentials Drop 01
SKU RICHBEIGELOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 58

Currently unavailable

View in 3DFull listing
Roti kebab black T-shirt

T-Shirt

Roti kebab black T-shirt

Rastah logo t-shirt with Rastah Volume V monogram screen printed on a midweight t-shirt.

Rastah logo t-shirt with Rastah Volume V monogram screen printed on a midweight t-shirt. The design on the back is a picture of a plate with a roti and a piece of kebab photographed at the rastah studio during lunch. Roti and Kebab is synonymous with the fast paced nature of Lahore as it is a quick and easy meal to prepare. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah Volume V monogram screen printed on front Roti Kebab digital print design on the back Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah Volume V monogram screen printed on front
  • Roti Kebab digital print design on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
ROTI KEBAB
Compare at
PKR 71
SKU ROTIKEBABBLACKT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 71

Currently unavailable

View in 3DFull listing
Roti kebab white T-shirt

T-Shirt

Roti kebab white T-shirt

Rastah logo t-shirt with Rastah Volume V monogram screen printed on a midweight t-shirt.

Rastah logo t-shirt with Rastah Volume V monogram screen printed on a midweight t-shirt. The design on the back is a picture of a plate with a roti and a piece of kebab photographed at the rastah studio during lunch. Roti and Kebab is synonymous with the fast paced nature of Lahore as it is a quick and easy meal to prepare. *THIS IS A LIMITED EDITION PIECE THAT WILL NOT BE MADE AGAIN ONCE SOLD OUT* slightly oversized fit 80% cotton and 20% polyester terry fabric Rastah Volume V monogram screen printed on front Roti Kebab digital print design on the back Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 80% cotton and 20% polyester terry fabric
  • Rastah Volume V monogram screen printed on front
  • Roti Kebab digital print design on the back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
ROTI KEBAB
Compare at
PKR 71
SKU ROTIKEBABWHITETSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 71

Currently unavailable

View in 3DFull listing
Royal creme logo T-shirt

T-Shirt

Royal creme logo T-shirt

Lightweight and oversized t shirt with Rastah's monogram printed on the front.

Lightweight and oversized t shirt with Rastah's monogram printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 19th of June. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
Summer Essentials Drop 01
SKU ROYALCREMELOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 58

Currently unavailable

View in 3DFull listing
Rust brown logo T-shirt

T-Shirt

Rust brown logo T-shirt

Lightweight and oversized t shirt with Rastah's monogram printed on the front.

Lightweight and oversized t shirt with Rastah's monogram printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 19th of June. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
Summer Essentials Drop 01
SKU RUSTBROWNLOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 58

Currently unavailable

View in 3DFull listing
Rust echoes knit shirt

T-Shirt

Rust echoes knit shirt

The Urban Echoes Knit Shirt is a cinematic tribute to the city's emotional landscape.

The Urban Echoes Knit Shirt is a cinematic tribute to the city's emotional landscape. This jacquard knit raglan shirt features a powerful, woven artwork of a solitary figure on the back, embodying introspective thought. The front displays an embroidered "Rastah 1818" logo, a subtle nod to the film Fallen Angels , making it a comfortable yet profound piece for the thoughtful soul. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: Premium Jacquard Knit: Intricate woven artwork on the back. Cinematic Art: A visual story of introspection. "1818" Reference: A nod to the movie Fallen Angels . Raglan Silhouette: Modern and comfortable fit. Care Instructions: Dry clean only

  • Premium Jacquard Knit: Intricate woven artwork on the back.
  • Cinematic Art: A visual story of introspection.
  • "1818" Reference: A nod to the movie Fallen Angels .
  • Raglan Silhouette: Modern and comfortable fit.
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU RUSTECHOESKNITSHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 220

Currently unavailable

View in 3DFull listing
Rust garden T-shirt

T-Shirt

Rust garden T-shirt

Crafted from 100% cotton with an acid-washed finish, it carries a hand block-printed pigeon motif — a symbol of longing and return — rendered in deep indigo tones.

Crafted from 100% cotton with an acid-washed finish, it carries a hand block-printed pigeon motif — a symbol of longing and return — rendered in deep indigo tones. A multihead embroidered patch adds a splash of color and intricacy to the chest, while the screen-printed logo on the sleeve ties it back to Rastah’s rooted identity. Key Features: 100% cotton, acid-washed finish Hand block-printed pigeon and floral design on front Multihead embroidered patch on chest Screen-printed logo on sleeve Relaxed fit Care Instructions: Hand wash separately in cold water using mild detergent. Do not bleach or tumble dry. Wash inside out to preserve print and embroidery. Line dry in shade and iron on low heat.

  • 100% cotton, acid-washed finish
  • Hand block-printed pigeon and floral design on front
  • Multihead embroidered patch on chest
  • Screen-printed logo on sleeve
  • Relaxed fit
Product type
T-Shirt
Vendor
BFCM 2025
SKU BLUESUBLIMATIONPATCHEMBROIDEREDT-SHIRT(COPY)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

Currently unavailable

View in 3DFull listing
Sadequain grey patch T-shirt

T-Shirt

Sadequain grey patch T-shirt

Oversized grey terry cloth t shirt with printed “rastah” logo patch on the front made of handwoven fabric.

Oversized grey terry cloth t shirt with printed “rastah” logo patch on the front made of handwoven fabric. The patch on the back showcases artwork by the immensely celebrated Pakistani artist Sadequain Ahmed Naqvi, known world over as Sadequain. The image, titled “soul and body”, first debuted as part of his 1970 exhibition, “Society and the Stranger”. Sadequain’s work rejects hollow aesthetic pursuit and yearns for deeper understanding. He explains his own work best, stating in an interview: ”People ask why I don't paint flowers, butterflies and landscapes? I tell them that I seek the truth and I am after reality. I am not inspired by someone posing against the backdrop of roses in a vase or pink curtains. What inspires me is a person who has gone hungry for hours and is struggling for survival. The expression that lights his face at the end of the day when he has finally found some scraps, that is what touches me. I am a painter of the expression of reality." He passed away in Karachi in 1987 and, to this day, few artists can claim as great an imprint on Pakistani culture. 260 gsm heavyweight terry Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in white color Male model wearing medium 5'10 Female model wearing small 5'5

  • 260 gsm heavyweight terry
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in white color
  • Male model wearing medium 5'10
  • Female model wearing small 5'5
Product type
T-Shirt
Vendor
VOLUME III
SKU SADEQUAINGREYPATCHT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Safar-E-Del resilience T-shirt

T-Shirt

Safar-E-Del resilience T-shirt

The Safar-e-Del Resilience Tee embodies the "Journey of the Heart," blending the raw beauty of urban life with the solace of art.

The Safar-e-Del Resilience Tee embodies the "Journey of the Heart," blending the raw beauty of urban life with the solace of art. Inspired by Sufi poetry and Persian miniatures, this off-white oversized tee features exquisite handmade crochet lace on sleeves and hem. A tiny embroidered flower graces the back, symbolizing hope, while a minimalist screen-printed logo completes this unique, comfortable garment – a wearable testament to enduring spirit. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: Premium Comfort: Soft, breathable fabric for a relaxed, oversized fit. Artisan Crochet Lace: Hand-stitched details on sleeves (with unique green/gold contrast) and a distinctive scalloped hem. Subtle Hope: Tiny embroidered flower on the back, representing resilience and innocence. Minimalist Branding: Discreet screen-printed logo on the front. Care Instructions: Dry clean only

  • Premium Comfort: Soft, breathable fabric for a relaxed, oversized fit.
  • Artisan Crochet Lace: Hand-stitched details on sleeves (with unique green/gold contrast) and a distinctive scalloped hem.
  • Subtle Hope: Tiny embroidered flower on the back, representing resilience and innocence.
  • Minimalist Branding: Discreet screen-printed logo on the front.
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU SAFAR-E-DELRESILIENCET-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
Safar-E-Gul block print T-shirt

T-Shirt

Safar-E-Gul block print T-shirt

A black terry t-shirt featuring hand block-printed roses and a detailed embroidered floral basket on the back.

A black terry t-shirt featuring hand block-printed roses and a detailed embroidered floral basket on the back. A tribute to lost innocence and quiet strength, drawn from the Safar-e-Del narrative. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features 100% terry cotton Hand block print & embroidery Relaxed fit Floral basket motif on back Urdu signature detail on chest Care Instructions Dry clean only

  • 100% terry cotton
  • Hand block print & embroidery
  • Relaxed fit
  • Floral basket motif on back
  • Urdu signature detail on chest
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU SAFAR-E-GULBLOCKPRINTT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 167

Currently unavailable

View in 3DFull listing
Sage made in PAK T-shirt (V2)

T-Shirt

Sage made in PAK T-shirt (V2)

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions.

Please note that slight color variations may occur between the physical product and the images due to minor dyeing differences and lighting conditions. Crafted with meticulous detail, this T-shirt discreetly showcases the Rastah emblem on the front, accompanied by the new "Made in Pakistan" inscription elegantly displayed in Urdu typography on the back. Constructed from 220 GSM cotton terry fabric, this shirt boasts an oversized fit, ensuring a relaxed yet stylish demeanor. Each garment is dyed to perfection, reflecting Rastah's commitment to quality and individuality. Key Features: Urdu Rastah logo on the front "Made in Pakistan" in Urdu typography on the back 220 GSM 100% cotton terry fabric Garment dyed Oversized fit Care Instructions: Machine wash cold with like colors Tumble dry low or hang dry Iron on low heat if needed, avoiding the printed areas Model Information: Male model: 5'11", wearing size Medium Female model: 5'6", wearing size Small

  • Urdu Rastah logo on the front
  • "Made in Pakistan" in Urdu typography on the back
  • 220 GSM 100% cotton terry fabric
  • Garment dyed
  • Oversized fit
  • Machine wash cold with like colors
  • Tumble dry low or hang dry
  • Iron on low heat if needed, avoiding the printed areas
  • Male model: 5'11", wearing size Medium
  • Female model: 5'6", wearing size Small
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU SAGEMADEINPAKT-SHIRT(V2)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Samba Spirit Tee

T-Shirt

Samba Spirit Tee

Inspired by the passion, creativity, and heritage of Brazilian football, the Football Base Brazil Heritage T-Shirt brings together bold cultural graphics with contemporary streetwear design.

Inspired by the passion, creativity, and heritage of Brazilian football, the Football Base Brazil Heritage T-Shirt brings together bold cultural graphics with contemporary streetwear design. Crafted from premium 100% cotton terry , this oversized tee offers exceptional softness, breathability, and all-day comfort. Featuring vibrant screen-printed artwork on the front and back, a ribbed neckline, and signature Rastah detailing, it delivers a standout look that celebrates football beyond the game. Key Features Premium 100% Cotton Terry Soft and breathable heavyweight fabric Oversized relaxed fit Ribbed crew neckline High-quality screen-printed artwork Front and back graphic design Signature Rastah woven patch Durable premium construction Comfortable everyday wear Football-inspired heritage graphics Soft-touch finish Designed for lasting comfort Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium 100% Cotton Terry
  • Soft and breathable heavyweight fabric
  • Oversized relaxed fit
  • Ribbed crew neckline
  • High-quality screen-printed artwork
  • Front and back graphic design
  • Signature Rastah woven patch
  • Durable premium construction
  • Comfortable everyday wear
  • Football-inspired heritage graphics
  • Soft-touch finish
  • Designed for lasting comfort
Product type
T-Shirt
Vendor
NYC Match Day Pop-Up
SKU BRAZILT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 158

Currently unavailable

View in 3DFull listing
Sand made in Pak Tshirt V6

T-Shirt

Sand made in Pak Tshirt V6

The Desert Sand Essential Tee is a timeless wardrobe staple designed with simplicity and comfort in mind.

The Desert Sand Essential Tee is a timeless wardrobe staple designed with simplicity and comfort in mind. Crafted from premium cotton in an oversized silhouette, it features a subtle embroidered Rastah logo on the chest, delivering understated character without compromising versatility. The warm sand-toned colorway makes it easy to style across seasons, while the relaxed fit ensures effortless everyday wear. Features Premium cotton construction Relaxed oversized fit Soft and breathable fabric Signature embroidered chest logo Ribbed crew neckline for lasting comfort Dropped shoulder design Clean minimalist aesthetic Warm desert sand colorway Lightweight feel for all-day wear Easy-to-style everyday essential Care Guide Machine wash cold with similar colors Wash inside out Do not bleach Tumble dry low or hang dry Cool iron if needed Do not iron directly on embroidery Avoid harsh detergents Store folded in a cool, dry place

  • Premium cotton construction
  • Relaxed oversized fit
  • Soft and breathable fabric
  • Signature embroidered chest logo
  • Ribbed crew neckline for lasting comfort
  • Dropped shoulder design
  • Clean minimalist aesthetic
  • Warm desert sand colorway
  • Lightweight feel for all-day wear
  • Easy-to-style everyday essential
  • Machine wash cold with similar colors
  • Wash inside out
Product type
T-Shirt
Vendor
CORE V6
SKU CAMELMADEINPAKT-SHIRT(V6)-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Sand wash graphic T-shirt

T-Shirt

Sand wash graphic T-shirt

Made from soft sand-washed jersey, the t-shirt features “Rastah — Made in Pakistan” embroidered at the center in contrasting threads using multihead embroidery.

Made from soft sand-washed jersey, the t-shirt features “Rastah — Made in Pakistan” embroidered at the center in contrasting threads using multihead embroidery. With its relaxed silhouette and textured surface, this piece captures a timeless aesthetic — a nod to heritage, comfort, and pride in craftsmanship. Key Features: Sand-washed cotton jersey fabric Central multihead embroidery reading “Rastah Made in Pakistan” Relaxed, oversized silhouette Ribbed neckline Dropped shoulders for an easy fit Soft hand-feel with vintage wash finish Care Instructions: Hand wash separately in cold water using mild detergent. Do not bleach or tumble dry. Wash inside out to preserve print and embroidery. Line dry in shade and iron on low heat.

  • Sand-washed cotton jersey fabric
  • Central multihead embroidery reading “Rastah Made in Pakistan”
  • Relaxed, oversized silhouette
  • Ribbed neckline
  • Dropped shoulders for an easy fit
  • Soft hand-feel with vintage wash finish
Product type
T-Shirt
Vendor
BFCM 2025
SKU RASTAHSANDWASHJERSEYT-SHIRT-S-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Sanjhi Yaadein T-Shirt

T-Shirt

Sanjhi Yaadein T-Shirt

Sanjhi yaadein — shared memories.

Sanjhi yaadein — shared memories. Not yours alone, not mine alone, but the ones that belong to both of us because we were both there. The Sanjhi Yaadein T-Shirt is built for those moments: a pink acid-wash tee that carries the softness of memory, the warmth of something that was lived together. On a pink acid-wash jersey base, the shirt leads with a front screen-printed RASTAH logo — clean, anchored, present. The back opens into an embroidered artwork, the needle-worked composition a reference to the kind of image that stays with you: specific enough to hold detail, soft enough at the edges to allow interpretation. Acid wash gives the pink a lived quality — not the pink of something new, but the pink of something already loved. Embroidery on the back of a tee is a commitment. It is a statement about what the shirt looks like when you walk away — what it leaves behind. The artwork worked into the back of this shirt is designed for that view, for the moment when someone watches you go and sees something worth remembering. Shared memories have a particular colour — warm, slightly faded, gentle at the edges. This shirt has found that colour and holds it. Key Features Pink acid-wash jersey construction Screen-printed RASTAH logo at front Embroidered back artwork Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Pink acid-wash jersey construction
  • Screen-printed RASTAH logo at front
  • Embroidered back artwork
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
Compare at
PKR 115
SKU SANJHIYAADEINT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 92

Currently unavailable

View in 3DFull listing
Scar garden T-shirt

T-Shirt

Scar garden T-shirt

Scar Garden is built around beauty that endured damage.

Scar Garden is built around beauty that endured damage. Crafted from 100% cotton, 220 GSM terry , the base carries distressed denim patches that are hand tie-dyed, embellished, and stitched onto the surface—each motif resembling a flower that bloomed after ruin. Inspired by Titunama’s recurring idea of forbidden beauty and irreversible consequence, this piece treats ornament as a wound, not decoration. Key Features 100% cotton, 220 GSM terry base Hand tie-dyed denim fabric patches Distressed, raw-edge patchwork detailing Hand-embellished floral-inspired motifs Stitch-applied patches across front, sleeves, and back Relaxed everyday fit Each piece slightly unique due to handmade processes Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton, 220 GSM terry base
  • Hand tie-dyed denim fabric patches
  • Distressed, raw-edge patchwork detailing
  • Hand-embellished floral-inspired motifs
  • Stitch-applied patches across front, sleeves, and back
  • Relaxed everyday fit
  • Each piece slightly unique due to handmade processes
Product type
T-Shirt
Vendor
TUTINAMA
SKU RASTAH-10423217783096

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 220

Currently unavailable

View in 3DFull listing
Scattered stars T-shirt

T-Shirt

Scattered stars T-shirt

Crafted from 100% cotton terry with a 220 GSM construction , this t-shirt combines expressive dye techniques with delicate hand embellishment.

Crafted from 100% cotton terry with a 220 GSM construction , this t-shirt combines expressive dye techniques with delicate hand embellishment. The garment features an earthy tie-dye finish , creating an organic pattern where tones blend and fade naturally across the surface. Scattered across the fabric are hand-applied bead embellishments , adding small bursts of color and texture that bring depth and visual movement to the piece. At the chest, a hand-embroidered Rastah logo provides a subtle signature detail that complements the artisanal nature of the garment. The interplay of dye, embroidery, and embellishment transforms the t-shirt into a tactile canvas — balancing handcrafted expression with a relaxed everyday silhouette. Key Features 100% cotton terry fabric 220 GSM construction Tie-dye finish throughout the garment Hand-embroidered Rastah logo on chest Hand-applied bead embellishments across the t-shirt Relaxed t-shirt silhouette Ribbed crew neckline Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton terry fabric
  • 220 GSM construction
  • Tie-dye finish throughout the garment
  • Hand-embroidered Rastah logo on chest
  • Hand-applied bead embellishments across the t-shirt
  • Relaxed t-shirt silhouette
  • Ribbed crew neckline
Product type
T-Shirt
Vendor
volume 15
SKU SCATTEREDSTARST-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 220

Currently unavailable

View in 3DFull listing
Sea green logo T-shirt

T-Shirt

Sea green logo T-shirt

Lightweight and oversized t-shirt with Rastah's monogram in gold printed on the front.

Lightweight and oversized t-shirt with Rastah's monogram in gold printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight pre shrunk terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 16th of August. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight pre shrunk terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
SUMMER ESSENTIALS DROP 02
SKU SEAGREENLOGOTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 60

Currently unavailable

View in 3DFull listing
Sethi House T-Shirt

T-Shirt

Sethi House T-Shirt

The Sethi House T-Shirt takes its name from the Sethi Mohalla of Peshawar — a neighbourhood of merchant havelis whose walls are carved with so much detail they seem to breathe.

The Sethi House T-Shirt takes its name from the Sethi Mohalla of Peshawar — a neighbourhood of merchant havelis whose walls are carved with so much detail they seem to breathe. This tee carries that same density of thought: a garment that refuses to be simple. Built on a zinc jersey base, the shirt combines three distinct embellishment techniques on one canvas. Multi-head machine embroidery works the khaddar patches sewn to the front and back, each patch derived from architectural motifs. The back carries a full screen-printed artwork composition, while the chest bears a clean screen-printed RASTAH logo that anchors the visual weight. Zinc is the quiet choice — neither the safety of black nor the noise of colour. It lets the patches speak. The khaddar panels break the jersey surface with texture, a material contrast that signals craft before the eye even processes the design beneath. The Sethi merchants were known for commissioning work that outlasted them — havelis built to hold memory across generations. This shirt operates in that spirit: layers of process, materials that have history, and a silhouette that belongs to now. Key Features Zinc jersey construction Multi-head machine-embroidered khaddar patches front and back Screen-printed back artwork Screen-printed RASTAH logo at chest Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Zinc jersey construction
  • Multi-head machine-embroidered khaddar patches front and back
  • Screen-printed back artwork
  • Screen-printed RASTAH logo at chest
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
Compare at
PKR 115
SKU SETHIHOUSET-SHIRT-S-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 92

In stock · ready to checkout

View in 3DBuy nowFull listing
Shehri babu vintage poster T-shirt

T-Shirt

Shehri babu vintage poster T-shirt

Oversized red terry cloth t-shirt with hand distressed, raw edges at the collar.

Oversized red terry cloth t-shirt with hand distressed, raw edges at the collar. A handwoven patch on the back showcases the 1953 Pakistani film – “Shehri Babu”. Shehri Babu was the first Punjabi language film to screen in Pakistan, and was met with such critical claim that is said to have the paved the way for Pakistan’s still rich and ever expanding Punjabi filmscape. The film’s iconic sound track, still referenced today, was created by famed music composer Rashid Attre and songstress Zubaida Khanum. 260 gsm heavyweight terry Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in white color Male model wearing medium 5'10 Female model wearing small 5'5

  • 260 gsm heavyweight terry
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in white color
  • Male model wearing medium 5'10
  • Female model wearing small 5'5
Product type
T-Shirt
Vendor
VOLUME III
SKU SHEHRIBABUVINTAGEPOSTERT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Siyahi Sketch T-shirt

T-Shirt

Siyahi Sketch T-shirt

Crafted from soft jersey fabric, the Around The Globe Tee is designed for everyday comfort with a clean front and impactful back graphic.

Crafted from soft jersey fabric, the Around The Globe Tee is designed for everyday comfort with a clean front and impactful back graphic. The relaxed silhouette and versatile cream color make it an effortless staple for daily wear. Features Soft jersey construction Screen-printed back design Classic crew neckline Relaxed fit Around The Globe branding Care Guide Machine wash cold Wash inside out Do not bleach Hang dry Do not iron directly on print Wash with similar colors

  • Soft jersey construction
  • Screen-printed back design
  • Classic crew neckline
  • Relaxed fit
  • Around The Globe branding
  • Machine wash cold
  • Wash inside out
  • Do not bleach
  • Hang dry
  • Do not iron directly on print
  • Wash with similar colors
Product type
T-Shirt
Vendor
CORE V6
SKU SIYAHISKETCHT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 88

In stock · ready to checkout

View in 3DBuy nowFull listing
Sky blue T-shirt (special edition)

T-Shirt

Sky blue T-shirt (special edition)

Crafted from 100% cotton terry with a weight of 180 GSM, this t-shirt blends everyday comfort with a bold cultural statement.

Crafted from 100% cotton terry with a weight of 180 GSM, this t-shirt blends everyday comfort with a bold cultural statement. The front features the Rastah logo in English paired with Urdu typography reading “Made in Pakistan,” while the back carries the unapologetic message: “Better than that European shit you wear” — a tribute to local pride, identity, and self-expression. Key Features: 100% Cotton terry, 180 GSM Oversized fit Front: English Rastah logo with Urdu typography Back: “Better than that European shit you wear” statement print Soft-washed finish Care Instructions: Machine wash cold Do not bleach Tumble dry low Iron on low heat Do not dry clean

  • 100% Cotton terry, 180 GSM
  • Oversized fit
  • Front: English Rastah logo with Urdu typography
  • Back: “Better than that European shit you wear” statement print
  • Soft-washed finish
  • Machine wash cold
  • Do not bleach
  • Tumble dry low
  • Iron on low heat
  • Do not dry clean
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU SKYBLUET-SHIRT(SPECIALEDITION)-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Skyline panel T-shirt

T-Shirt

Skyline panel T-shirt

Crafted from soft jersey fabric, it features contrasting white and black shoulder panels that add structure and movement to the silhouette.

Crafted from soft jersey fabric, it features contrasting white and black shoulder panels that add structure and movement to the silhouette. The front bears a subtle Urdu logo print, while the back showcases a bold screen-printed Rastah insignia — balancing restraint and confidence. Designed for everyday wear, the piece reflects effortless versatility and a touch of nostalgic athleticism. Key Features: 100% cotton jersey Panelled shoulders with contrast detailing Screen-printed logo on front and back Ribbed crew neckline Oversized, relaxed fit for comfort Care Instructions: Hand wash or gentle machine wash in cold water. Wash inside out to protect embroidery and print. Do not bleach. Lay flat or hang to dry in the shade.

  • 100% cotton jersey
  • Panelled shoulders with contrast detailing
  • Screen-printed logo on front and back
  • Ribbed crew neckline
  • Oversized, relaxed fit for comfort
Product type
T-Shirt
Vendor
BFCM 2025
Compare at
PKR 97
SKU SKYLINEPANELT-SHIRTS-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 87

In stock · ready to checkout

View in 3DBuy nowFull listing
Space grey logo T-shirt

T-Shirt

Space grey logo T-shirt

Lightweight and oversized t shirt with Rastah's monogram printed on the front.

Lightweight and oversized t shirt with Rastah's monogram printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 19th of June. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
Summer Essentials Drop 01
SKU SPACEGREYLOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 58

Currently unavailable

View in 3DFull listing
Starseeker T-shirt

T-Shirt

Starseeker T-shirt

An oversized off-white t-shirt crafted for dreamers and wanderers.

An oversized off-white t-shirt crafted for dreamers and wanderers. Made from soft 100% cotton, it features a minimal Urdu logo screen-printed on the chest, while the back reveals a surreal illustration by Pakistani artist Maha Farooq — blending handwritten Urdu, cosmic forms, and drifting eyes. A visual journal stitched into streetwear, celebrating the journey between cities, cultures, and inner worlds. Crafted from soft, midweight cotton with dropped shoulders and a relaxed fit, this tee merges South Asian expression with global streetwear attitude. Key Features: 100% cotton Oversized fit with dropped shoulders Screen-printed Urdu logo on front Surreal, handwritten-style graphic on the back Off-white color with soft washed finish Care Instructions: Machine wash cold Wash inside out with similar colors Tumble dry low or hang dry Iron on reverse side, avoid print contact

  • 100% cotton
  • Oversized fit with dropped shoulders
  • Screen-printed Urdu logo on front
  • Surreal, handwritten-style graphic on the back
  • Off-white color with soft washed finish
  • Machine wash cold
  • Wash inside out with similar colors
  • Tumble dry low or hang dry
  • Iron on reverse side, avoid print contact
Product type
T-Shirt
Vendor
STUDIO 54
SKU STARSEEKERT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 106

Currently unavailable

View in 3DFull listing
Steel grey logo T-shirt

T-Shirt

Steel grey logo T-shirt

Lightweight and oversized t shirt with Rastah's monogram printed on the front.

Lightweight and oversized t shirt with Rastah's monogram printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 19th of June. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
Summer Essentials Drop 01
SKU STEELGREYLOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 58

Currently unavailable

View in 3DFull listing
Stitched Note T-Shirt

T-Shirt

Stitched Note T-Shirt

A stitched note is not the same as a typed one.

A stitched note is not the same as a typed one. It carries the time it took, the person who made it, the particular quality of hand applied to fabric that no machine can reproduce exactly. The Stitched Note T-Shirt is that kind of object — a message in textile, written slowly, meant to be read closely. On a sand-colour acid-wash jersey, screen-printed front artwork covers the body — a composition that uses the full front surface as its canvas. At the back, screen-printed Urdu text runs across the shirt, a language choice that is both visual and legible, design and declaration simultaneously. The acid wash gives the sand base a worn quality, as if the note has already been carried for a while before arriving here. Urdu script is visually extraordinary — its letterforms have a calligraphic movement that makes text function as pattern even before it is read. Placing it as a back print turns the shirt into something that is read from behind, that completes its statement as you walk away. Sand-colour acid wash is the quiet foundation that lets both print compositions work without competition. Notes get kept. The meaningful ones get reread. This shirt is the kind of note you keep. Key Features Sand acid-wash jersey construction Screen-printed front artwork Screen-printed Urdu text at back Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Sand acid-wash jersey construction
  • Screen-printed front artwork
  • Screen-printed Urdu text at back
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
Compare at
PKR 115
SKU STITCHEDNOTET-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 92

In stock · ready to checkout

View in 3DBuy nowFull listing
Studio brown jacquard T-shirt

T-Shirt

Studio brown jacquard T-shirt

A snug silhouette born from the streets of SoHo and the soul of South Asia.

A snug silhouette born from the streets of SoHo and the soul of South Asia. This mink-brown jacquard knit crop tee hugs close with soft texture and Urdu typography woven across the chest—blurring the lines between poetry, punk, and polished high fashion. Care Instructions: Dry clean only Do not bleach Iron on low heat inside out Avoid direct exposure to sunlight for prolonged periods Key Features: Textured jacquard knit fabric Cropped fitted silhouette Short sleeves with stretch High neckline for structured elegance Urdu woven text at chest Soft hand feel, comfortable against skin

  • Dry clean only
  • Do not bleach
  • Iron on low heat inside out
  • Avoid direct exposure to sunlight for prolonged periods
  • Textured jacquard knit fabric
  • Cropped fitted silhouette
  • Short sleeves with stretch
  • High neckline for structured elegance
  • Urdu woven text at chest
  • Soft hand feel, comfortable against skin
Product type
T-Shirt
Vendor
STUDIO 54
Compare at
PKR 222
SKU STUDIOBROWNJACQUARDTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 165

In stock · ready to checkout

View in 3DBuy nowFull listing
Super mechanic bros - sky blue T-shirt

T-Shirt

Super mechanic bros - sky blue T-shirt

Drops 05/22, ships 05/25.

Drops 05/22, ships 05/25. This shirt is a reimagination of the Super Mario Bros games if it were made in Pakistan. The main characters would be Mechanics rather than plumbers, hence the name change to “ Super Mistery (mechanic) Brothers”. The text above the characters reads as “chotay pana laien”. The main character is asking his apprentice to bring the wrench. The apprentice replies “Aya ustand jee” which translate to “on my way”. The Rastah logo on the front is inspired by the nintendo logo. slightly oversized fit 280 gsm terry in a cotton and polyester mix Reimagined Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 280 gsm terry in a cotton and polyester mix
  • Reimagined Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
MAY CAPSULE
Compare at
PKR 84
SKU SUPERMECHANICBROS-SKYBLUET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 84

Currently unavailable

View in 3DFull listing
Surkh garam mirchi black T-shirt

T-Shirt

Surkh garam mirchi black T-shirt

Drops 05/22, ships 05/25.

Drops 05/22, ships 05/25. This T-shirt is an Urdu reimagination of the tour merch for the 90’s alternative rock band “Red hot chili peppers”. The band logo on the back has been converted to Urdu text which reads “ Surkh garam mirchain”. slightly oversized fit 280 gsm terry in a cotton and polyester mix Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry

  • slightly oversized fit
  • 280 gsm terry in a cotton and polyester mix
  • Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
MAY CAPSULE
Compare at
PKR 84
SKU SURKHGARAMMIRCHAINBLACKT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 84

Currently unavailable

View in 3DFull listing
Tears of clay knit shirts

T-Shirt

Tears of clay knit shirts

This rust-hued knit jacquard shirt is adorned with a repeating paisley motif, echoing the fluidity of emotion and nostalgia.

This rust-hued knit jacquard shirt is adorned with a repeating paisley motif, echoing the fluidity of emotion and nostalgia. The front bears the Rastah logo in Urdu script, a quiet declaration of identity in a chaotic world. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: 100% cotton knit jacquard Repeated paisley pattern inspired by South Asian motifs Urdu Rastah logo at the chest Relaxed fit for everyday comfort Care Instructions: Dry clean only

  • 100% cotton knit jacquard
  • Repeated paisley pattern inspired by South Asian motifs
  • Urdu Rastah logo at the chest
  • Relaxed fit for everyday comfort
  • Dry clean only
Product type
T-Shirt
Vendor
SOFTBOY SEASON
SKU TEARSOFCLAYKNITSHIRTS-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 158

Currently unavailable

View in 3DFull listing
Teri surat black thermal T-shirt

T-Shirt

Teri surat black thermal T-shirt

An oversized black thermal tee, with hand distressed, raw edges at the collar.

An oversized black thermal tee, with hand distressed, raw edges at the collar. A handwoven khaddar patch on the back showcases a poster for the 1971 Pakistani film – “Teri Surat Meri Aankein”. VOLUME III celebrates the epoch of art and culture in Pakistan, from the 1950s up until the Zia dictatorship of the 1980s, and the collection is full of mid-century references to this first ‘golden age’ of Pakistani cinema. 260 gsm heavyweight terry Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in white color Male model wearing medium 5'10 Female model wearing small 5'5

  • 260 gsm heavyweight terry
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in white color
  • Male model wearing medium 5'10
  • Female model wearing small 5'5
Product type
T-Shirt
Vendor
VOLUME III
SKU TERISURATBLACKTHERMALTEE-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Test run - "+92" royal blue patch T-shirt

T-Shirt

Test run - "+92" royal blue patch T-shirt

Elevate your wardrobe with this piece, meticulously crafted from 100% midweight 270gsm cotton for ultimate comfort.

Elevate your wardrobe with this piece, meticulously crafted from 100% midweight 270gsm cotton for ultimate comfort. The oversized fit ensures a relaxed yet stylish look. The patch on the back, handwoven from cotton, serves as a poignant reminder of the situation in Pakistan - a colorful and inviting facade hiding a broken and conflicted reality. The Urdu script text on the patch reads, "We are unable to reach the current number," symbolizing the difficulties faced by many. The front of the shirt features the Rastah logo and Pakistan's cell phone area code, tying the design together. Midweight 270gsm cotton for optimal comfort Oversized fit for a relaxed yet stylish look Handwoven cotton patch on the back representing the situation in Pakistan Urdu script text on the patch Rastah logo and Pakistan's cell phone area code on the front Male model 5'11 wearing medium, female model 5'8 wearing medium Available for purchase on the 25th of April, with shipping starting on the 27th.

  • Midweight 270gsm cotton for optimal comfort
  • Oversized fit for a relaxed yet stylish look
  • Handwoven cotton patch on the back representing the situation in Pakistan
  • Urdu script text on the patch
  • Rastah logo and Pakistan's cell phone area code on the front
  • Male model 5'11 wearing medium, female model 5'8 wearing medium
Product type
T-Shirt
Vendor
APRIL CAPSULE 23
SKU TESTRUN-+92ROYALBLUEPATCHTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
The “zinda aurat” acid wash patch T-shirt

T-Shirt

The “zinda aurat” acid wash patch T-shirt

This piece is a collaboration between Pakistani digital creator “king marium” and explores concepts of identity, power dynamics and gender equality, under a framework of post-censorship political and cultural discourse.

This piece is a collaboration between Pakistani digital creator “king marium” and explores concepts of identity, power dynamics and gender equality, under a framework of post-censorship political and cultural discourse. One of the patches a female army officer in a hijab, and the other patch is an archived redacted newspaper. The pitches are printed on ecru hand woven slub khaddar fabric. The front of the Sweatshirt also includes INTERMISSION III custom designed logo, never to be reintroduced again, printed on hand woven fabric. The t-shirt is constructed from 100% compact combed 270 gsm cotton terry, custom milled for Rastah. *THIS IS A LIMITED EDITION ITEM WHICH WILL NOT BE RESTOCKED ONCE SOLD OUT* Slightly oversized fit Dropped shoulders 270 GSM compact combed terry (custom milled) “Rastah” Volume IV patch 100% cotton Printed Khaddar fabric patches on the front and back Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'11; Wearing Medium | Female Model: 5'5; Wearing Small

  • Slightly oversized fit
  • Dropped shoulders
  • 270 GSM compact combed terry (custom milled)
  • “Rastah” Volume IV patch
  • 100% cotton
  • Printed Khaddar fabric patches on the front and back
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'11; Wearing Medium | Female Model: 5'5; Wearing Small
Product type
T-Shirt
Vendor
Intermission III
SKU THE“ZINDAAURAT”ACIDWASHPATCHTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
The Caravan Route T-Shirt

T-Shirt

The Caravan Route T-Shirt

The caravan route did not belong to one culture.

The caravan route did not belong to one culture. It passed through all of them, exchanging material and language and design as it moved. The Caravan Route T-Shirt is built in that spirit — a meeting point of techniques and materials that have their own separate histories, arriving together on a single garment. On a yellow jersey base, traditional motifs are laser-cut from khaddar and applied to the shirt surface. Jute sublimation patches sit on the front alongside the khaddar, a pairing of two very different material weights and textures. Screen-printed front artwork runs across the body, creating a final layer over the combined surface. Yellow is the colour of the caravan in full light — visible, warm, unmistakable on the horizon. The laser-cut khaddar motifs are from the traditions that lined that route: geometric patterns that survived centuries of travel because they were simple enough to remember and complex enough to mean something. The jute patches ground the shirt in a rougher, earthier material register. Routes are not destinations. They are processes, encounters, accumulations. This shirt is assembled the same way — from things that were already moving, brought together at one point on the map. Key Features Yellow jersey construction Laser-cut traditional motifs in khaddar applied to surface Jute sublimation front patches Screen-printed front artwork Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Yellow jersey construction
  • Laser-cut traditional motifs in khaddar applied to surface
  • Jute sublimation front patches
  • Screen-printed front artwork
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
SKU THECARAVANROUTET-SHIRT-L-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 115

In stock · ready to checkout

View in 3DBuy nowFull listing
The empress - orange T-shirt

T-Shirt

The empress - orange T-shirt

The design is based on the Tarot card by the same name “the empress” which represents motherhood, nature, art, beauty and harmony.

The design is based on the Tarot card by the same name “the empress” which represents motherhood, nature, art, beauty and harmony. The garment itself has hand screen printed elements on front and back. slightly oversized fit 200 gsm heavyweight fleece in a cotton and polyester mix Rastah logo printed on the front hand screen printed elements throughout Washing/Handling: Hand wash with cold water inside out & hang to dry Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small

  • slightly oversized fit
  • 200 gsm heavyweight fleece in a cotton and polyester mix
  • Rastah logo printed on the front
  • hand screen printed elements throughout
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
  • Male Model: 5'10 and 150 lbs wearing: Medium | Female Model: 5'9 and 105 lbs wearing small
Product type
T-Shirt
Vendor
INTERMISSION VI
Compare at
PKR 86
SKU THEEMPRESS-ORANGET-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 86

Currently unavailable

View in 3DFull listing
THE ETERNAL VOICE T-SHIRT

T-Shirt

THE ETERNAL VOICE T-SHIRT

Inspired by Pakistan's rich artistic heritage, the Nusrat Graphic Jersey T-Shirt is crafted from premium jersey fabric for superior comfort and everyday wear.

Inspired by Pakistan's rich artistic heritage, the Nusrat Graphic Jersey T-Shirt is crafted from premium jersey fabric for superior comfort and everyday wear. Featuring a clean minimalist front with a bold Nusrat-inspired screen print on the back, this tee blends cultural expression with contemporary streetwear. Soft, breathable, and designed for effortless styling. Features Premium jersey fabric Soft, breathable, and lightweight Classic crew neckline Relaxed everyday fit Minimal front branding Nusrat-inspired screen print on the back Durable ribbed neckline Designed for all-day comfort Care Guide Machine wash cold with similar colors Wash inside out Do not bleach Tumble dry low or line dry Warm iron inside out if needed Do not iron directly on the print Do not dry clean

  • Premium jersey fabric
  • Soft, breathable, and lightweight
  • Classic crew neckline
  • Relaxed everyday fit
  • Minimal front branding
  • Nusrat-inspired screen print on the back
  • Durable ribbed neckline
  • Designed for all-day comfort
  • Machine wash cold with similar colors
  • Wash inside out
  • Do not bleach
  • Tumble dry low or line dry
Product type
T-Shirt
Vendor
CORE V6
SKU NUSRATLEGACYGRAPHICT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
The Last Line T-Shirt

T-Shirt

The Last Line T-Shirt

The last line is always the one that stays with you.

The last line is always the one that stays with you. It's what the poem was working toward, what the letter finally says, what the story couldn't hold back any longer. The Last Line T-Shirt is built around that kind of accumulated intensity — a garment that arrives at its full statement only when you see everything together. On a jersey base, the shirt is embellished with Sindhi ajrak — a hand-block printed and resist-dyed textile from Sindh, one of the most technically complex regional crafts in South Asia. Alongside it, fancy sequins catch light across the surface. A hand-embroidered logo patch anchors the chest, worked in dabka — a form of metal wire embroidery — alongside assorted threads and additional embellishments that give the piece its final, layered statement. Ajrak is a process that takes weeks: the fabric goes through multiple dyeing and printing stages, each one dependent on the last. The end result is a surface that has absorbed that time, that carries it visibly. Sequins in combination with ajrak is a meeting of the festive and the classical — both traditions reach for light, just through different means. The last line of this shirt is spoken in dabka, in ajrak, in sequin. It is worth reading slowly. Key Features Jersey construction Sindhi ajrak embellishment across body Fancy sequin detailing Hand-embroidered logo patch in dabka and assorted thread Mixed embellishment construction Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Jersey construction
  • Sindhi ajrak embellishment across body
  • Fancy sequin detailing
  • Hand-embroidered logo patch in dabka and assorted thread
  • Mixed embellishment construction
Product type
T-Shirt
Vendor
Dastkari
Compare at
PKR 115
SKU THELASTLINET-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 92

In stock · ready to checkout

View in 3DBuy nowFull listing
The og full-sleeve T-shirt

T-Shirt

The og full-sleeve T-shirt

The Full-Sleeve Jersey T-Shirt blends athletic structure with streetwear identity.

The Full-Sleeve Jersey T-Shirt blends athletic structure with streetwear identity. Cut in a rich brown base with contrast piping details, the silhouette references classic cricket training jerseys while keeping a relaxed everyday fit. The front features a minimal Rastah script logo, while the back carries bold, full-scale screen-printed artwork that anchors the piece in club culture. Designed as a statement layer, the jersey works both as standalone outerwear and as part of a styled set. The 100% cotton construction ensures breathable comfort, while the full front and back screen print adds strong visual impact without compromising wearability. Key Features 100% cotton construction Full-sleeve jersey silhouette Contrast piping detail along shoulders and sides Screen-printed Rastah logo at front Large-scale screen print graphic at back Relaxed athletic fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton construction
  • Full-sleeve jersey silhouette
  • Contrast piping detail along shoulders and sides
  • Screen-printed Rastah logo at front
  • Large-scale screen print graphic at back
  • Relaxed athletic fit
Product type
T-Shirt
Vendor
SS’26
SKU THEOGFULL-SLEEVET-SHIRT-M-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 79

In stock · ready to checkout

View in 3DBuy nowFull listing
The Painted Garden T-Shirt

T-Shirt

The Painted Garden T-Shirt

The Painted Garden T-Shirt is named for what gardens have always been: acts of imagination imposed on landscape.

The Painted Garden T-Shirt is named for what gardens have always been: acts of imagination imposed on landscape. Mughal gardens, Persian paradise gardens, the chaarbagh — these are not natural spaces. They are visions pressed into earth. This tee carries that same impulse: colour and pattern as transformation. On a pink jersey base, a direct block print runs across the entire body of the shirt — not a patch, not a panel, but the full fabric treated as a single composition. The chest carries a screen-printed RASTAH logo, clean and deliberate against the blooming surface beneath it. Block printing directly onto a garment rather than applying printed panels changes the relationship between design and structure. The print lives in the fabric, not on top of it. It moves with the shirt, breathes with it, softens with every wash. Pink amplifies the garden reference — it is the colour of peonies, of certain roses, of late afternoon light on pale stone. Gardens are made to be walked through slowly, looked at closely. This shirt rewards the same attention — at a distance it reads as colourful, up close it reveals the registration marks and ink variations that tell you exactly how it was made. Key Features Pink jersey construction Direct all-over block print on garment body Screen-printed RASTAH logo at chest Relaxed fit Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Pink jersey construction
  • Direct all-over block print on garment body
  • Screen-printed RASTAH logo at chest
  • Relaxed fit
Product type
T-Shirt
Vendor
Dastkari
SKU THEPAINTEDGARDENT-SHIRT-M-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 145

In stock · ready to checkout

View in 3DBuy nowFull listing
The rich kid club T-shirt

T-Shirt

The rich kid club T-shirt

A cold-dyed jersey t-shirt finished in earthy black-brown tones, giving it a textured and lived-in appearance.

A cold-dyed jersey t-shirt finished in earthy black-brown tones, giving it a textured and lived-in appearance. The front carries minimal embroidery, while the back features a bold screen-printed graphic reading “The Rich Kid Club” , making it a cultural and streetwear statement piece. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. 🔹 Key Features Cold dye treatment on jersey cotton Each piece uniquely textured Minimal front logo embroidery Bold screen-printed graphic on back Relaxed, oversized fit Streetwear-inspired edge with artisanal finish 🔹 Care Instructions Hand wash or machine wash on cold cycle with mild detergent. Wash inside out to protect prints and colours. Do not bleach. Dry on low heat cycle or lay flat in shade.

  • Cold dye treatment on jersey cotton
  • Each piece uniquely textured
  • Minimal front logo embroidery
  • Bold screen-printed graphic on back
  • Relaxed, oversized fit
  • Streetwear-inspired edge with artisanal finish
  • Hand wash or machine wash on cold cycle with mild detergent.
  • Wash inside out to protect prints and colours.
  • Do not bleach.
  • Dry on low heat cycle or lay flat in shade.
Product type
T-Shirt
Vendor
CORE F/W-25
SKU THERICHKIDCLUBT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 88

Currently unavailable

View in 3DFull listing
The silent climb T-shirt

T-Shirt

The silent climb T-shirt

A cream cotton t-shirt with a hand-drawn style screen print that blends nature, water, and ascent — a symbolic journey toward love eternal.

A cream cotton t-shirt with a hand-drawn style screen print that blends nature, water, and ascent — a symbolic journey toward love eternal. A visual poem of hope, colour, and memory. Key Features 100% cotton terry Multicolour screen print on the back Minimal front logo print Relaxed unisex silhouette Ribbed neckline Care Instructions Hand wash or machine wash on cold cycle with mild detergent. Wash inside out to protect prints and colours. Do not bleach. Dry on low heat cycle or lay flat in the shade.

  • 100% cotton terry
  • Multicolour screen print on the back
  • Minimal front logo print
  • Relaxed unisex silhouette
  • Ribbed neckline
Product type
T-Shirt
Vendor
A Summer in Firenze
SKU THESILENTCLIMBT-SHIRTS-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 101

Currently unavailable

View in 3DFull listing
The window still glows T-shirt

T-Shirt

The window still glows T-shirt

A black cotton t-shirt featuring a hand-drawn café façade in soft pastel hues, screen printed with Urdu text that recalls forgotten streets and quiet moments.

A black cotton t-shirt featuring a hand-drawn café façade in soft pastel hues, screen printed with Urdu text that recalls forgotten streets and quiet moments. A scene of longing rendered in color and line—an echo of places that live only in memory. Key Features 100% cotton, 220 GSM Multicolour screen print on back Minimal Urdu logo print on front Ribbed neckline Relaxed unisex fit Care Instructions Hand wash or machine wash on cold cycle with mild detergent. Wash inside out to protect prints and colours. Do not bleach. Dry on low heat cycle or lay flat in the shade.

  • 100% cotton, 220 GSM
  • Multicolour screen print on back
  • Minimal Urdu logo print on front
  • Ribbed neckline
  • Relaxed unisex fit
Product type
T-Shirt
Vendor
A Summer in Firenze
SKU THEWINDOWSTILLGLOWST-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 101

Currently unavailable

View in 3DFull listing
Tilework T-shirt

T-Shirt

Tilework T-shirt

A modern silhouette meets timeless tradition.

A modern silhouette meets timeless tradition. This oversized t-shirt features heritage-inspired block printing across the front and back, contrasted with solid black paneling. Finished with a bold Urdu logo on the chest, it's a clean yet intricate take on cultural streetwear. Key Features: 100% cotton Block-printed front and back panel Contrasting solid black sleeve and side Oversized fit Screen-printed Urdu logo on chest Unisex design Care Instructions: Machine wash cold with like colors Turn inside out before washing Do not bleach Tumble dry low or hang to dry Iron on reverse side if needed

  • 100% cotton
  • Block-printed front and back panel
  • Contrasting solid black sleeve and side
  • Oversized fit
  • Screen-printed Urdu logo on chest
  • Unisex design
  • Machine wash cold with like colors
  • Turn inside out before washing
  • Do not bleach
  • Tumble dry low or hang to dry
  • Iron on reverse side if needed
Product type
T-Shirt
Vendor
STUDIO 54
SKU TILEWORKTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 167

Currently unavailable

View in 3DFull listing
Unfiltered T-shirt

T-Shirt

Unfiltered T-shirt

Crafted from cotton terry, this t-shirt features a puff printed RASTAH logo on the front, layered with Urdu screen-printed text.

Crafted from cotton terry, this t-shirt features a puff printed RASTAH logo on the front, layered with Urdu screen-printed text. A screen-printed logo detail appears on the sleeve, adding subtle branding. The back showcases a jute sublimation patch with embroidered heart motifs and Urdu text. Raw edges on the patch enhance the handcrafted character of the garment. Key Features Cotton terry fabric Puff printed RASTAH logo on front Urdu screen print overlay Screen-printed logo on sleeve Jute sublimation patch on back Embroidered hearts and Urdu text Raw edge patch detailing Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Cotton terry fabric
  • Puff printed RASTAH logo on front
  • Urdu screen print overlay
  • Screen-printed logo on sleeve
  • Jute sublimation patch on back
  • Embroidered hearts and Urdu text
  • Raw edge patch detailing
Product type
T-Shirt
Vendor
volume 15
SKU UNFILTEREDT-SHIRT-XS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

In stock · ready to checkout

View in 3DBuy nowFull listing
Unscripted T-shirt

T-Shirt

Unscripted T-shirt

Crafted from 100% cotton terry with a 220 GSM construction , this black t-shirt blends everyday comfort with expressive visual storytelling.

Crafted from 100% cotton terry with a 220 GSM construction , this black t-shirt blends everyday comfort with expressive visual storytelling. The heavyweight terry fabric offers a soft yet structured feel, giving the garment a relaxed silhouette suited for daily wear. The front features two overlapping khaddar fabric patches , creating a layered textile focal point. A screen-printed Rastah logo sits over the patch, adding contrast while highlighting the handcrafted construction. On the back, a bold screen-printed artwork composition unfolds through expressive lines, symbols, and abstract sketches surrounding the Rastah lettering. The raw, sketch-like graphics capture the spirit of unfiltered creativity — reflecting thoughts and ideas as they emerge naturally, without structure or restraint. Key Features 100% cotton terry fabric 220 GSM construction Black colorway Two overlapping khaddar fabric patches on front Screen-printed Rastah logo over patch Large screen-printed artwork on back Relaxed t-shirt silhouette Ribbed crew neckline Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton terry fabric
  • 220 GSM construction
  • Black colorway
  • Two overlapping khaddar fabric patches on front
  • Screen-printed Rastah logo over patch
  • Large screen-printed artwork on back
  • Relaxed t-shirt silhouette
  • Ribbed crew neckline
Product type
T-Shirt
Vendor
volume 15
SKU UNSCRIPTEDT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 97

In stock · ready to checkout

View in 3DBuy nowFull listing
Untold story T-shirt

T-Shirt

Untold story T-shirt

A jersey t-shirt constructed with a 220 GSM fabric weight for structure and comfort.

A jersey t-shirt constructed with a 220 GSM fabric weight for structure and comfort. The design features layered graphic elements and textile detailing. A khaddar patch with a laser cut Rastah logo adds contrast. A jute sublimation patch and screen printed artwork complete the composition. Key Features Jersey fabric construction 220 GSM fabric weight Laser cut Rastah logo on khaddar patch Jute sublimation patch Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Jersey fabric construction
  • 220 GSM fabric weight
  • Laser cut Rastah logo on khaddar patch
  • Jute sublimation patch
Product type
T-Shirt
Vendor
volume 15
SKU UNTOLDSTORYT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing
Vintage Black Acid Wash

T-Shirt

Vintage Black Acid Wash

A contemporary streetwear essential, this oversized T-shirt is crafted from soft cotton jersey with a vintage-inspired black acid wash finish.

A contemporary streetwear essential, this oversized T-shirt is crafted from soft cotton jersey with a vintage-inspired black acid wash finish. The back showcases a striking laser-cut denim appliqué logo paired with a crescent moon graphic, creating texture, depth, and a handcrafted aesthetic. Designed with a relaxed silhouette and dropped shoulders, it delivers effortless comfort while making a bold visual statement. Features Premium cotton jersey construction Black acid wash treatment for a unique vintage look Laser-cut denim appliqué artwork on the back Crescent moon graphic detail Oversized unisex fit Dropped shoulder design Soft, breathable fabric for everyday comfort Reinforced ribbed crew neckline Each garment features slight wash variations, making every piece unique Care Guide Machine wash cold inside out Wash with similar dark colors Use mild detergent Do not bleach Do not tumble dry Hang dry in shade Iron on low heat from the reverse side

  • Premium cotton jersey construction
  • Black acid wash treatment for a unique vintage look
  • Laser-cut denim appliqué artwork on the back
  • Crescent moon graphic detail
  • Oversized unisex fit
  • Dropped shoulder design
  • Soft, breathable fabric for everyday comfort
  • Reinforced ribbed crew neckline
  • Each garment features slight wash variations, making every piece unique
  • Machine wash cold inside out
  • Wash with similar dark colors
  • Use mild detergent
Product type
T-Shirt
Vendor
CORE V6
SKU LASER-CUTDENIMTEE-S-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 106

In stock · ready to checkout

View in 3DBuy nowFull listing
Virsa block print T-shirt

T-Shirt

Virsa block print T-shirt

Crafted with a balance of traditional artistry and modern detailing, this T - shirt features all-over hand block printing across the front, back, and sleeves.

Crafted with a balance of traditional artistry and modern detailing, this T - shirt features all-over hand block printing across the front, back, and sleeves. A laser-cut logo at the front adds a refined contemporary touch, complemented by a laser-cut paisley motif at the back. Designed in 100 % cotton with a relaxed, comfortable fit, it's ideal for both everyday wear and elevated styling. KEY FEATURES 100% cotton fabric All-over hand block print detailing Laser-cut brand logo at the front Laser-cut paisley motif at the back Relaxed and comfortable fit Breathable fabric suitable for all-day wear Handmade details may vary slightly, making each piece unique CARE INSTRUCTIONS Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect patch and prints Do not bleach Lay flat or hang to dry in the shade

  • 100% cotton fabric
  • All-over hand block print detailing
  • Laser-cut brand logo at the front
  • Laser-cut paisley motif at the back
  • Relaxed and comfortable fit
  • Breathable fabric suitable for all-day wear
  • Handmade details may vary slightly, making each piece unique
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
Whispering Walls
SKU VIRSABLOCKPRINTT-SHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
White logo T-shirt

T-Shirt

White logo T-shirt

This lightweight terry fabric shirt features our classic monogrom logo and a ribbed collar.

This lightweight terry fabric shirt features our classic monogrom logo and a ribbed collar. Creme White “Rastah” Urdu logo embroidered across the centre 80/20 cotton poly ratio Slightly oversized silhouette 280 gsm Dropped shoulders Washing/Handling: Hand wash with cold water inside out & hang to dry

  • Creme White
  • “Rastah” Urdu logo embroidered across the centre
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • 280 gsm
  • Dropped shoulders
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
VOLUME III
SKU WHITELOGOT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 49

Currently unavailable

View in 3DFull listing
White logo T-shirt

T-Shirt

White logo T-shirt

Lightweight and oversized t-shirt with Rastah's monogram in black printed on the front.

Lightweight and oversized t-shirt with Rastah's monogram in black printed on the front. slightly oversized fit 80% cotton and 20% polyester lightweight pre shrunk terry fabric Rastah monogram screen printed on front Washing/Handling: Hand wash with cold water inside out & hang to dry *This is a limited edition item. No restocks* *This item will be available for purchase on the 16th of August. 1pm EST/ 10pm PKT*

  • slightly oversized fit
  • 80% cotton and 20% polyester lightweight pre shrunk terry fabric
  • Rastah monogram screen printed on front
  • Washing/Handling: Hand wash with cold water inside out & hang to dry
Product type
T-Shirt
Vendor
SUMMER ESSENTIALS DROP 02
SKU WHITELOGOTSHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 60

Currently unavailable

View in 3DFull listing
White patch T-shirt

T-Shirt

White patch T-shirt

Basic oversized ecru terry t shirt.

Basic oversized ecru terry t shirt. A hand-woven patch on the back showcases a vintage tourism poster, first issued by the Pakistan Ministry of Tourism in the 1970s. The subject of the poster, the Wazir Khan mosque in Lahore, was commissioned by Mughal Emperor Shah Jehan in 1634 and is considered one of the greatest extant examples of Mughal tile work in the world. 260 gsm heavyweight terry Raw edges at sleeves and hem 80/20 cotton poly ratio Slightly oversized silhouette Dropped shoulders Washing/handling: hand wash with cold water and hang to dry Rastah monogram on front in white color Male model wearing medium 5'10 Female model wearing small 5'5

  • 260 gsm heavyweight terry
  • Raw edges at sleeves and hem
  • 80/20 cotton poly ratio
  • Slightly oversized silhouette
  • Dropped shoulders
  • Washing/handling: hand wash with cold water and hang to dry
  • Rastah monogram on front in white color
  • Male model wearing medium 5'10
  • Female model wearing small 5'5
Product type
T-Shirt
Vendor
VOLUME III
SKU WHITEPATCHT-SHIRT-S-01

Sizes / variants: S · M · L · XL

LAIZ escrow price

PKR 79

Currently unavailable

View in 3DFull listing
Yaadoun Ka Box T-Shirt

T-Shirt

Yaadoun Ka Box T-Shirt

Every household has one box of yaadein.

Every household has one box of yaadein. Old photographs, dried flowers from someone's first wedding, bus tickets, a tape with no label. This piece is that box turned into fabric. Photographed memories converted into patches, layered across denim, khaddar, silk, and jute. A central jute logo patch at the front, fashion stitches, and embroidery thread it all together, a complete archive worn on the chest. Part of the Threads of Nostalgia capsule is a collection rooted in late-20th- and early-21st-century Pakistani memory. Cassette tapes, slow Sunday mornings, nani's almari, gol gappay walay ki cycle. This drop translates those moments into hand-finished streetwear, designed to live with you, not just be owned. Key Features Premium 180 GSM cotton jersey base Photographed visuals converted into patches Laser-cut denim and khaddar patches Silk and jute sublimation patches Centralized jute patch logo at the front Layered mixed-media composition Fashion stitches and embroidery detailing Hand-finished garment, minor irregularities are part of the craft Care Instructions Hand wash or gentle cold-cycle machine wash with mild detergent Wash inside out to protect the patch and prints Do not bleach Lay flat or hang to dry in the shade

  • Premium 180 GSM cotton jersey base
  • Photographed visuals converted into patches
  • Laser-cut denim and khaddar patches
  • Silk and jute sublimation patches
  • Centralized jute patch logo at the front
  • Layered mixed-media composition
  • Fashion stitches and embroidery detailing
  • Hand-finished garment, minor irregularities are part of the craft
  • Hand wash or gentle cold-cycle machine wash with mild detergent
  • Wash inside out to protect the patch and prints
  • Do not bleach
  • Lay flat or hang to dry in the shade
Product type
T-Shirt
Vendor
Threads of Nostalgia
SKU YAADOUNKABOXT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 132

Currently unavailable

View in 3DFull listing
Yellow regular fit embroidered logo T-shirt

T-Shirt

Yellow regular fit embroidered logo T-shirt

This White Jersey regular fit T-Shirt brings a fresh, vibrant look with bold yellow rib accents on the sleeves and crew neckline.

This White Jersey regular fit T-Shirt brings a fresh, vibrant look with bold yellow rib accents on the sleeves and crew neckline. The yellow embroidered Rastah logo on the chest adds a touch of cultural flair. This shirt combines comfort and style, making it a perfect choice for casual and streetwear-inspired looks. Fabric Details Material : Soft and breathable jersey fabric, ensuring all-day comfort. Weight : 220 GSM, providing structure while maintaining a lightweight feel. Design Features Yellow Ribbed Accents : Contrasting yellow ribbing on the sleeves and neckline for a pop of color. Embroidered Logo : Signature Yellow Rastah logo on the chest for a distinctive touch. Regular Fit : Comfortable and classic fit designed for everyday wear. Fit Fitting : Regular fit, offering a comfortable and relaxed look. Care Instructions Machine wash in cold water on a gentle cycle. Avoid bleach to preserve fabric and logo quality. Air dry to retain the fabric's softness. Use a cool iron on the reverse side if needed.

  • Material : Soft and breathable jersey fabric, ensuring all-day comfort.
  • Weight : 220 GSM, providing structure while maintaining a lightweight feel.
  • Yellow Ribbed Accents : Contrasting yellow ribbing on the sleeves and neckline for a pop of color.
  • Embroidered Logo : Signature Yellow Rastah logo on the chest for a distinctive touch.
  • Regular Fit : Comfortable and classic fit designed for everyday wear.
  • Fitting : Regular fit, offering a comfortable and relaxed look.
  • Machine wash in cold water on a gentle cycle.
  • Avoid bleach to preserve fabric and logo quality.
  • Air dry to retain the fabric's softness.
  • Use a cool iron on the reverse side if needed.
Product type
T-Shirt
Vendor
CORE COLLECTION
SKU YELLOWREGULARFITEMBROIDEREDLOGOTSHIRT-XS-01

Sizes / variants: XS · S · M · L · XL

LAIZ escrow price

PKR 93

Currently unavailable

View in 3DFull listing
Zameen-Zadey T-shirt

T-Shirt

Zameen-Zadey T-shirt

Crafted from soft terry cotton, this black t-shirt merges comfort with culture.

Crafted from soft terry cotton, this black t-shirt merges comfort with culture. The back features an elaborate screen-printed design inspired by folk symbols and Urdu script, transforming the piece into a modern-day visual poem. Please note: Size may vary by ± 0.5 inches. Colors and stitch/patch details may differ slightly from images due to handmade processes and display settings. Key Features: 100% cotton terry fabric Screen-printed multicolor graphic on back Urdu calligraphy logo printed on front Soft and breathable with a textured finish Relaxed fit with ribbed neckline Care Instructions: Dry clean only

  • 100% cotton terry fabric
  • Screen-printed multicolor graphic on back
  • Urdu calligraphy logo printed on front
  • Soft and breathable with a textured finish
  • Relaxed fit with ribbed neckline
  • Dry clean only
Product type
T-Shirt
Vendor
Songs of the Desert
SKU ZAMEEN-ZADEYT-SHIRT-XXS-01

Sizes / variants: XXS · XS · S · M · L · XL · XXL

LAIZ escrow price

PKR 115

Currently unavailable

View in 3DFull listing